Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 154947-66-7 Cathelicidin LL-37 Lyophilized Powder Peptide Raw Material
LL37 154947-66-7 Cathelicidin LL-37    Lyophilized Powder  Peptide Raw Material buy - large image1
LL37 154947-66-7 Cathelicidin LL-37    Lyophilized Powder  Peptide Raw Material buy - image1
LL37 154947-66-7 Cathelicidin LL-37    Lyophilized Powder  Peptide Raw Material buy - image2
LL37 154947-66-7 Cathelicidin LL-37    Lyophilized Powder  Peptide Raw Material buy - image3
LL37 154947-66-7 Cathelicidin LL-37    Lyophilized Powder  Peptide Raw Material buy - image4
LL37 154947-66-7 Cathelicidin LL-37    Lyophilized Powder  Peptide Raw Material buy - image5
LL37 154947-66-7 Cathelicidin LL-37    Lyophilized Powder  Peptide Raw Material buy - image6

LL37 154947-66-7 Cathelicidin LL-37 Lyophilized Powder Peptide Raw Material

TDS 1 Inquiries

Unit Price:

$80/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

guangzhou

Brand:

HKX

Packaging:

5mg/vial

Price valid (until):

2027-01-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Semaglutide,Retatrutide,MOTS-C,GHK-CU,MT-2

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Please contact me :Anna
    Whatsapp:+852 56821040
    Email:iamok000@outlook.com
    1.   We supply high-purity research-grade Tirzepatide peptide, available in lyophilized powder form in sterile vials. All batches are HPLC-tested to ensure purity ≥99%。
    Items Specifications
    Product Name LL37
    CAS NO. 154947-66-7
    Appearance Lyophilized Powder
    Purity 99%
    Molecular Weight 4493
    Specification 5mg/vial
    Storage conditions −20°C

    Mechanism of Action

    1.Broad-spectrum antimicrobial activity

    LL-37 acts directly on microbial membranes:

    ·Disrupts bacterial cell membrane structure

    ·Increases membrane permeability

    ·Causes leakage of intracellular contents

    ·Ultimately leads to killing of bacteria, fungi, and certain viruses

    2️⃣ Immunomodulatory effects

    LL-37 is not only an antimicrobial peptide but also an immune regulatory molecule:
    ·Regulates innate immune responses

    ·Modulates inflammatory cytokines (e.g., TNF-α, IL-6)

    ·Promotes chemotaxis and activation of immune cells


    3️⃣ Promotion of tissue repair and wound healing

    LL-37 plays an important role in tissue regeneration:
    ·Enhances epithelial cell migration

    ·Accelerates wound closure

    ·Involved in angiogenesis

    ·Regulates the local inflammatory microenvironment


    4️⃣ Anti-biofilm activity

    ·Disrupts bacterial biofilm structures

    ·Improves resistance to infection

    ·Enhances antibiotic susceptibility


    Shop LL37 154947-66-7 Cathelicidin LL-37    Lyophilized Powder  Peptide Raw Material-Detailed Image 1 Shop LL37 154947-66-7 Cathelicidin LL-37    Lyophilized Powder  Peptide Raw Material-Detailed Image 2 Shop LL37 154947-66-7 Cathelicidin LL-37    Lyophilized Powder  Peptide Raw Material-Detailed Image 3 Shop LL37 154947-66-7 Cathelicidin LL-37    Lyophilized Powder  Peptide Raw Material-Detailed Image 4 Shop LL37 154947-66-7 Cathelicidin LL-37    Lyophilized Powder  Peptide Raw Material-Detailed Image 5 Shop LL37 154947-66-7 Cathelicidin LL-37    Lyophilized Powder  Peptide Raw Material-Detailed Image 6

    Q&A

    Q: When can I receive the package?

    A: It will be shipped as soon as possible after payment, and the shipping time is generally 7 to 15 days.

    Q: What is the minimum amount I can order?

    A: The minimum quantity we can order is 1 box, which contains 10 vials.

    Q:How about the price? Can you make it cheaper?

    A:We always take the customer's benefit as the top priority. Price is negotiable under different conditions, we are assuring you to get the most competitive price.

    Q: How do i keep the peptides when i receive it ?

    A: Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.


    Company Profile

         

    HKX is a reliable manufacturer and exporter of peptide raw materials.


    We have strong R&D capabilities and advanced production facilities. Our products cover various synthetic peptides and related raw materials, which are widely used in scientific research and pharmaceutical development. Every batch of goods undergoes rigorous laboratory testing to meet international quality standards.


    We have years of international trade experience and a complete logistics system. Neutral packaging is used for all goods to comply with international shipping regulations. We provide flexible order solutions for customers, from small trial orders to large bulk purchases.


    Sticking to the philosophy of Quality Priority and Customer Oriented, we sincerely welcome customers from all over the world to negotiate business and create win-win cooperation.

    Shop HIGH-Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 9


    Shop HIGH-Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 10


    Why Choose Us

    ·Ultra-High Purity Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

    ·Accurate Dosing & Consistency Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

    ·Endotoxin-Free & Sterile Processing Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    ·Retail and bulk orders are accepted.

    ·Neutral packaging with full sealing for safe international shipping.

    ·Fast dispatch within 1-3 working days after payment confirmation.

    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss CAS 2023788-19-2     lyophilized powder-Detailed Image 12


    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss CAS 2023788-19-2     lyophilized powder-Detailed Image 13

    Contact Us

    Please contact us if you have any doubts regarding our products or enterprise.

    We provide dedicated service for all clients.


    Shop LL37 154947-66-7 Cathelicidin LL-37    Lyophilized Powder  Peptide Raw Material-Detailed Image 11

    Certificates
    • LL37 154947-66-7 Cathelicidin LL-37    Lyophilized Powder  Peptide Raw Material Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Semaglutide,Retatrutide,MOTS-C,GHK-CU,MT-2

    Location:

    203, NO. 88 Zhongxin North Road, Hangzhou Avenue Sub-district, Binhai New Area, Tianjin

    Payment Terms:

    TT against copy of documents,D/P,D/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    12

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    51-100

    Year of Establishment:

    2026

       Our company is a professional enterprise engaged in the chemical industry for many years, specializing in the import and export of chemical raw materials, fine chemicals, industrial additives, and related products.
       With a well-established supply chain system and strict quality control standards, we integrate high-quality manufacturing resources to ensure stable product quality and reliable supply. Our product portfolio covers general chemicals, fine chemicals, rubber and plastic raw materials, water treatment chemicals, and other related categories, serving both domestic and international markets.
       Adhering to the principles of integrity, quality first, and mutual benefit, we strictly control product quality and delivery timelines. We provide comprehensive one-stop foreign trade solutions, including product sourcing, customized selection, logistics coordination, and customs clearance services according to customer requirements.
       Leveraging extensive industry experience and a well-developed global sales network, we are committed to meeting diverse international procurement needs. We aim to build a stable and trustworthy bridge for global chemical trade and establish long-term, sustainable partnerships with clients worldwide.
  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.