Name :Sally
Whatsapp/wechat:+86 17631983757
Email:sales5@xtlmh.com
LL 37 peptide, also known as CAP-18 for Cathelicidin antimicrobial peptide 18, is a 37 amino acid cationic peptide.LL 37 is also a typical linear antimicrobial peptide which can eliminate a wide range of pathogenes, including bacteria, viruses, fungi, and parasites. CAP-18 is the only human cathelicidin peptide reported yet, found in lysosomes of macrophages and leukocytes
Antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. Also triggers apoptosis in colon cancer cells. Cell permeable.
The human body mainly produces two types of antimicrobial peptides: defensin family peptides and cathelicidin family peptides. Although there are many members of the defensin family of peptides, cathelicidin has only one antimicrobial peptide product, LL-37. LL-37 is the C-terminal cleavage product of cathelicidin peptide Hcap-18, which directly kills bacteria, fungi and viruses.
| Sequence : [LL-37, 37 aa] |
| MW : 4 493.4 Da (C205H340N60O53) |
| Purity : > 99% |
| Other names : Cathelicidin,154947-66-7, All38 peptide, BAC4, CAP18, CAMP, |
| Peptide Solubility Guideline |
| Bulk peptide quantities available |
What is the Benefit of LI 37 Peptide?
1. Immune Support
2. Antimicrobial Properties
3. Wound Healing
4. Anti-inflammatory Effects
5. Angiogenesis Promotion
6. Anti-tumor Potential
7. Skin Health
8. Neuroprotective Effects
LingMi BioTechnology Co., Ltd， The company spirit of "customer first, integrity first principle, with a number of enterprises to establish long-term cooperative relations. Adhere to the quality of survival, creation and development, honest, trustworthy business philosophy, adhere to the "everything quality, customer satisfaction, new, people-oriented quality policy, and constantly improve and perfect themselves. To scientific management, advanced equipment, continuous innovation, to meet the needs of customers. Good reputation and high quality products, has been the majority of domestic and foreign merchants consistent trust. Won the trust of our customers and won the praise of customers!
1. Higher quality products (>=99% purity) for most of peptides and raws. Quality Guaranteed: Many HPLC test reports are available .
2. Domestic warehouses and stocks: USA, Canada, Europe and Australia.
3. Ship worldwide with safe and secure lines: 100% delivery guaranteed. No worry about Customs issues.
4. Special Service: Drop-shipping if need.
5. Cheapest prices in the market, unbeatable！
6. Double-clearance express, safer and more efficient.
Q1: How to confirm the Product Quality before placing orders?
A: By sending you available samples. Or if you have special requirements for the goods, we can prepare samples according to your requirement for confirmation.
Q2: Can you supply free samples?
A: Yes, we can provide a free sample, but the shipping cost will be paid by the customers. You can either pay the shipping cost or arrange a courier to collect the samples.
Q3: How do you treat quality complaints?
A: All our products are strictly tested by our QC and confirmed by QA; unqualified material will not be released to customers. In case any quality problem is confirmed to be caused by us, we will replace the goods or refund your payment immediately.
Q4: What's your MOQ ?
A: For the high value product, our MOQ starts from 1g and generally starts from 10gs. For other low, price product, our MOQ starts from 100g and 1kg.
Q: Is there a discount ?
A: Yes, for larger quantity, we always support with better price.
Q5: How to start orders or make payments ?
A: You can send our your Purchase order ( if your company has ), or just send a simple confirmation by email or by Trade Manager, and we will send you Proforma Invoice with our bank details for your confirmation, then you can make payment accordingly.
