High-quality, best-selling peptide raw material powder FOXO4-DRI

Product Description

WhatsAPP+85247317681

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

Function & Application

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

Appearance: Powder

Purity: >98% (or refer to the Certificate of Analysis)

Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

Solubility: To be determined

Shelf Life: >2 years if stored properly

Drug Formulation: To be determined

Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

HS Tariff Code: 2934.99.9001

  FAQ   

Q1: How to confirm the Product Quality before placing orders?
A: By sending you available samples. Or if you have special requirements for the goods, we can prepare samples according to your requirement for confirmation.
Q2: Can you supply free samples?
A: Yes, we can provide a free sample, but the shipping cost will be paid by the customers. You can either pay the shipping cost or arrange a courier to collect the samples.
Q3: How do you treat quality complaints?
A: All our products are strictly tested by our QC and confirmed by QA; unqualified material will not be released to customers. In case any quality problem is confirmed to be caused by us, we will replace the goods or refund your payment immediately.
Q4: What's your MOQ ?
A: For the high value product, our MOQ starts from 1g and generally starts from 10gs. For other low, price product, our MOQ starts from 100g and 1kg.
Q: Is there a discount ?
A: Yes, for larger quantity, we always support with better price.
Q5: How to start orders or make payments ?
A: You can send our your Purchase order ( if your company has ), or just send a simple confirmation by email or by Trade Manager, and we will send you Proforma Invoice with our bank details for your confirmation, then you can make payment accordingly.