Cosmetic grade anti-aging FOXO4 cas2460055-10-9 High Purity for Raw Peptide Powder factory supply fast delivery

Linkman: Yara
WhatsApp: +852 6011 9564
Email : tengchu02@zhuanjinbio.com

Products Name:  Fox04
CAS No.: 2460055-10-9
Purity: >99.0%
Appearance: White Lyophilized powder
Reconstitution: Required 
Storage:After reconstitution store at 2°C - 8°C

Product Description

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

Function & Application

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

    Product transportation: We have warehouses in the United States, Canada, Mexico, Australia, and Germany, and can ship from overseas warehouses to improve our transportation efficiency and allow customers to receive packages quickly. In addition, we also cooperate with international express companies such as FEDEX, UPS, TNT EMS, etc. In addition, we are more adept at using dedicated air freight lines for transportation. Specializing in the transportation of chemical products and other international logistics. You can receive your package safely.

    Customers do not need to provide customs clearance information. We provide DDP service. Door-to-door service. There is no need to sign for the package in person. We have more than ten years of experience in chemical trade.

    Customs: 100% safe delivery, free re-delivery of any customs problems, guaranteed delivery.

FAQ

Q1: May I get one sample before placing order?
Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.

Q2: Which payment is available for your company?
Re: T/T,Bitcoin etc. You can choose the one which is convenient for you.

Q3: How and when can I get my goods after payment?
Re: For small quantity products, they will be delivered to you by international courier(DHL, FedEx, TNT etc.) or by air. Usually it will cost 3-10days that you can get the goods after delivery.For large quantity products, shipping by see is worthwhile.It will cost 15 to 30 days to come to your destination port, which depends on where the port is.

Q4: Is there any possible to use my appointed label or package?
Re: Yes. If needed, we'd like to use label or package according to your requirement.

Q5: How can you guarantee the goods you offer is qualified?
Re: We always believe honesty and responsibility are basis of one company, so whatever products we provide for you all are qualified. We will have goods tested and provide COA before delivery for sure.