Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides
Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides buy - large image1
Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides buy - image1
Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides buy - image2
Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides buy - image3
Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides buy - image4
Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides buy - image5
Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides buy - image6

Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides

TDS 10 Inquiries

Unit Price: Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Chinese mainland

Brand:

any

Packaging:

10mg*10vials

Price valid (until):

2026-08-27

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Semag lutide,Tirzepatide,Retatrutide,raw material,GHK-CU,TB500(Thymosin B4 AceTate)

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Name:Rain

    Whatsapp:+852 69948372

    Email:rain@anymang.cn

    Triple Agonist Design :

    GLP-1 receptor: Retatrutide delays gastric emptying, suppress appetite, and promote secretion.

    GIP receptor: Retatrutide enhances sensitivity and regulate central satiety signals.

    Glucagon receptor (GCGR): Retatrutide activates liver energy metabolism, promote lipolysis and glycogenolysis, and increase basal metabolic rate.

    The triple synergistic effect increases energy consumption while reducing energy intake, significantly improving weight loss effects.


    Basic Information
    Product Name: Retatrutide
    Specification: 20mg per vial
    CAS Number: 2381089-83-2
    Molecular Formula: C221H342N46O68
    Molecular Weight: 4813.5
    Appearance: White lyophilized solid powder
    Purity: ≥99.5% as determined by HPLC
    Product Grade: Standard laboratory research grade
    Solubility: Freely soluble in bacteriostatic water and purified water
    Product Brief Introduction
    Retatrutide belongs to the series of synthetic polypeptide raw materials and is widely used in fundamental research in modern laboratories. The product is produced via full chemical synthesis, followed by multi-stage purification and professional vacuum freeze-drying treatment. The finished powder features uniform texture without caking, stable physical properties and constant chemical composition.
    High-quality synthetic starting materials are adopted for production, and all processing procedures are completed in a standardized dust-free workshop. Unified operating specifications are implemented throughout the production process to effectively control batch variation and guarantee consistent quality across different batches. All finished products will undergo comprehensive testing at an independent third-party professional testing institution before shipment. Complete test files, authentic test data and standard analysis documents can be provided to facilitate daily laboratory data sorting and experimental reference.
    Core Product Advantages
    Adopted rigorous purification technology with low impurity content, suitable for high-precision laboratory experiments. Accurate filling quantity with sufficient active ingredients and stable component ratio. Mature vacuum freeze-drying technology effectively extends the stable storage period. Fast dissolution rate; the resulting solution is homogeneous without visible precipitates. Constant sufficient stock ensures stable supply capacity, supporting spot orders and bulk procurement. A comprehensive internal quality control system is established, and standard test documents are available for each batch. Diverse customization services are available, including label revision and outer carton style customization. Constant-temperature protective packaging is applied to maintain the inherent stability of materials during transportation.
    Testing Implementation Standard
    All testing items are carried out in accordance with internationally recognized testing standards for laboratory raw materials. Main testing indicators include core purity, residual moisture, foreign substance content and basic physical parameters. All test results comply with the general acceptance criteria for research raw materials. The 20mg specification products of this batch have passed all routine testing items with authentic and valid data, fully meeting the requirements of daily basic laboratory research, formula exploration and relevant academic research.
    Standard Storage Guidelines
    Long-term storage: Keep sealed at -20℃, avoid strong light and humid air. Short-term daily storage: Store in a sealed state under refrigeration. Storage after reconstitution: Keep the reconstituted solution refrigerated and use it up within 7 days. Repeated freeze-thaw cycles over a long period are prohibited to prevent damage to the inherent stability of raw materials.
    Solvent Preparation Guidelines
    Select suitable laboratory-specific solvents according to practical experimental plans. Add solvent slowly and dissolve with gentle shaking. Violent shaking of the solution is forbidden. Maintain a stable dissolution environment to preserve the original properties of the material. Prepare solutions at target concentrations for subsequent laboratory operations.
    Complete Packaging Specifications
    Single vial package: 20mg lyophilized raw material is sealed in a standard glass vial equipped with professional rubber stopper and aluminum crimp cap, together with an independent dust-proof and moisture-proof outer bag. Inner box package: 10 vials are packed in one fixed inner box with shockproof lining to prevent collision damage. Shipping outer carton: Thickened 5-layer export carton with overall sealing and reinforcement, delivering excellent moisture-proof, drop-proof and compression-resistant performance. All outer packaging complies with international general logistics standards. Clear marks of product specifications, storage reminders and fragile labels are printed on the outer package.
    Logistics & Cooperation Service
    Safe delivery is available to most regions worldwide. For such laboratory raw materials, we adopt dedicated temperature-controlled packaging solutions to ensure stable material status during long-distance transportation. Flexible order arrangement, prompt shipment and smooth follow-up order docking services are supported.
    General Usage Notice
    This product is only applicable to professional laboratory scientific research, academic project research and raw material formula development. It cannot be used for direct external application or any non-research purposes. Purchasers shall use this product in compliance with local relevant industry regulations and standard laboratory operating procedures.
    Main Application Fields
    It is applicable to basic research in biological laboratories, preliminary exploration of new raw materials, experimental research for academic institutions, data research of basic scientific projects and other formal research areas. It has gained consistent recognition among research institutions and research-related traders all over the world.
    Product Advantages
    Ultra-high purity with tested purity reaching 99.52%, low impurity level to reduce experimental interference factors. Precise net content with sufficient feeding volume; the actual active content exceeds the marked specification with stable effective components. Advanced freeze-drying technology extends the storage cycle and reduces the risk of deterioration and inactivation. Excellent solubility with rapid dissolution; the prepared solution is clear without precipitation. Abundant spot inventory guarantees stable supply, supporting wholesale and retail orders. Strict quality inspection system with complete test documents, facilitating customs clearance and business cooperation for customers. Customizable specifications, labels and private brand packaging services are available. Professional cold-chain packaging and transportation effectively prevent the loss of peptide activity caused by high temperature.
    Quality Inspection Standard
    We adopt internationally universal HPLC detection standards, strictly controlling product purity, moisture content, related substances, heavy metal content and microbial limits. All indicators meet international industry standards for research peptides. The 20mg finished products of this batch have passed all formal testing items with complete test data and authentic results, which can fully satisfy various academic research, laboratory tests, formula development and other scientific research demands.
    Storage Method
    Long-term storage: Seal and store at -20℃, protected from light and moisture. Short-term storage: Keep sealed at 2-8℃ in cool environment. After reconstitution: Store under refrigeration and consume within 7 days. Repeated freeze-thaw operations are strictly forbidden, as they may lead to decreased peptide activity and product failure.
    Reconstitution Suggestion
    Based on experimental requirements, select appropriate bacteriostatic water or sterile water for gentle dissolution. Shake slowly until fully dissolved. Avoid violent shaking to prevent damage to peptide activity. Prepare quantitative solutions at target concentrations for subsequent experimental operations.
    Packaging Specification
    Single unit package: 20mg lyophilized powder filled in standard medical glass vial, sealed with rubber stopper and aluminum cap, with independent moisture-proof package. Inner box: 10 vials per box with built-in shockproof foam to avoid collision and breakage. Export outer carton: Thickened 5-layer corrugated carton with reinforced sealing, moisture-proof, drop-proof and pressure-resistant. All export packaging meets international logistics standards, printed with clear shipping marks, product information, storage requirements and fragile signs.
    Logistics & Service
    Global safe transportation is supported. Professional low-temperature constant-temperature transportation solutions are adopted for peptide products to maintain stable activity during long-distance transit. Multiple payment methods are supported, with fast order scheduling, timely delivery and complete after-sales communication.
    Application Scope
    Widely applied in biological laboratory research, pharmaceutical raw material investigation, experimental research of university research institutions, new component development, scientific project tests and other professional research scenarios. It is highly trusted by research institutes, pharmaceutical R&D enterprises and scientific research traders across the globe.
    Keywords
    Retatrutide, Retatrutide 20mg, CAS 2381089-83-2, Triple Receptor Agonist, Lyophilized Peptide Powder, High Purity Peptide, Research Grade Peptide, Lab Research Raw Material, Bulk Peptide Supply, Factory Direct Peptide Supply

    Product name Retatrutide
    Purity 99%
    Appearance White powder
    Specifications 10mg/vial
    Shop Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides-Detailed Image 1
    Shop Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides-Detailed Image 2
    Shop Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides-Detailed Image 3
    Shop Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides-Detailed Image 4
    Shop Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides-Detailed Image 5
    Shop Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides-Detailed Image 6
    Shop Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides-Detailed Image 7
    Shop Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides-Detailed Image 8
    Shop Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides-Detailed Image 9
    Shop Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides-Detailed Image 10
    ECHEMI Editorial Reference
    The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
    Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.

    Certificates
    • Wholesale Janoshik high 99% Weight Loss Peptides Retatrutide (GLP 1/GLP1/Reta) wholesale price beauty peptides Certificates 1 TDS

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Research
    Class:

    Triple agonist — GCGR, GIPR, GLP-1R

    Status:

    Investigational (Phase 3)

    Mechanism:

    Simultaneously activates glucagon receptor (GCGR), glucose-dependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R). Engineered from the native GIP backbone with amino acid substitutions to confer GCGR and GLP-1R activity.

    EC50 (Human GCGR):

    5.79 nM

    EC50 (Mouse GIPR):

    0.191 nM

    EC50 (Mouse GLP1R):

    0.794 nM

    EC50 (Mouse GCGR):

    2.32 nM

    EC50 (Human GLP1R):

    0.775 nM

    EC50 (Human GIPR):

    0.0643 nM

    Source:

    Jastreboff AM, et al. N Engl J Med. 2023;389(6):514-526.DOI

    Clinical Development:

    NCT04881760; NCT05882045; NCT06354660

    References
    ChEMBL:

    CHEMBL5095485

    DrugBank:

    DB18993

    KEGG DRUG:

    D12430

    PubChem:

    PubChem

    Disclaimer:

    Retatrutide is an investigational compound not yet approved by FDA or EMA. This listing is for industrial and laboratory research use only. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Semag lutide,Tirzepatide,Retatrutide,raw material,GHK-CU,TB500(Thymosin B4 AceTate)

    Location:

    Room 1002-C3973, No. 80, Yongtai Modaonan Street, Yongping Subdistrict, Baiyun District, Guangzhou City

    Payment Terms:

    TT against copy of documents,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    45

    Year of Establishment:

    2026

    Anymang is a US-based trading company dedicated to the global supply and formulation of high-quality cosmetic raw materials, with a core focus on peptide ingredients. Committed to bridging premium suppliers and beauty manufacturers worldwide, we deliver pure, stable, and efficacious peptides—including anti-aging, brightening, and firming peptides—alongside a full spectrum of cosmetic actives and custom formulation solutions. With rigorous quality control and compliance with US safety standards, we ensure consistent batch quality and reliable delivery. Our experienced team provides professional technical support and tailored services to help clients develop competitive skincare and personal care products. Trusted by partners across the globe, Anymang stands as your dependable partner for innovative, high-performance cosmetic raw materials and peptide formulations.

  • Inquiry History
    10 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.