Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > MOTS-c for Sale > LL-37 99%+ High Purity Peptide 5 mg per Vial
LL-37  99%+ High Purity Peptide  5 mg per Vial buy - large image1
LL-37  99%+ High Purity Peptide  5 mg per Vial buy - image1
LL-37  99%+ High Purity Peptide  5 mg per Vial buy - image2
LL-37  99%+ High Purity Peptide  5 mg per Vial buy - image3
LL-37  99%+ High Purity Peptide  5 mg per Vial buy - image4
LL-37  99%+ High Purity Peptide  5 mg per Vial buy - image5
LL-37  99%+ High Purity Peptide  5 mg per Vial buy - image6

LL-37 99%+ High Purity Peptide 5 mg per Vial

TDS 128 Inquiries

Unit Price: Get Latest Price
CAS No.:

1627580-64-6

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GUANGZHOU

Brand:

APKX

Packaging:

5 mg per Vial

Price valid (until):

2026-07-23

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  



    Product Description



    LL-37 is a synthetic 37‑amino‑acid cationic peptide with the sequence H‑Leu‑Leu‑Gly‑Asp‑Phe‑Phe‑Arg‑Lys‑Ser‑Lys‑Glu‑Lys‑Ile‑Gly‑Lys‑Glu‑Phe‑Lys‑Arg‑Ile‑Val‑Gln‑Arg‑Ile‑Lys‑Asp‑Phe‑Leu‑Arg‑Asn‑Leu‑Val‑Pro‑Arg‑Thr‑Glu‑Ser‑OH (one‑letter code: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES). It has a molecular formula of C₂₀₅H₃₄₀N₆₀O₅₃ and a molecular weight of approximately 4493.33 g/mol. LL-37 is the only known human cathelicidin – a class of host defense peptides that form a critical component of the body‘s innate biological systems. It is constitutively expressed in human skin and is significantly upregulated in response to environmental stressors such as UV radiation, mechanical stimulation, and inflammatory signals.

    In cosmetic formulation research, LL-37 is of interest for its potential to help maintain healthy skin barrier function, support the skin‘s natural adaptive responses to environmental stress, and promote a balanced, radiant complexion.

    .

    1. Ultra-High Purity

    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.
    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.
    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.


    Sales manager:  Eira

    whatsapp:+8619304441463 

    whatsapp:+852 9546  9358

    Email:  sales01@cnspks.com


    1. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.


    2. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.


    Shop IGF 1LR3-Detailed Image 1


    Shop IGF 1LR3-Detailed Image 2 Shop IGF 1LR3-Detailed Image 3


    Q1: May I get one sample before placing order?
    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.
    Q2: Which payment is available for your company?
    Re: T/T, PayPal,bank transfer etc. You can choose the one which is convenient for you.
    Q3: How and when can I get my goods after payment?
    Re: For small quantity products, they will be delivered to you by international courier(DHL, FedEx, TNT etc.) or by air. Usually it will cost 5-7days that you can get the goods after delivery.For large quantity products, shipping by see is worthwhile.It will cost 15 to 30 days to come to your destination port, which depends on where the port is.
    Q4: Is there any possible to use my appointed label or package?
    Re: Yes. If needed, we'd lik.


    Shop IGF 1LR3-Detailed Image 4


    Shop IGF 1LR3-Detailed Image 5

    1. Expertise in Peptide Synthesis
    Extensive Experience: 7 Years of expertise in synthetic peptide development.
    Skilled Team: Experts in solid-phase and liquid-phase synthesis.
    2. Advanced Manufacturing Capabilities
    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.
    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.
    3. Innovation & Customer Commitment
    Reliable Supply Chain: Competitive pricing & timely global delivery.
    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.
    4. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.
    5.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.
    6.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.



    Shop IGF 1LR3-Detailed Image 6 Shop IGF 1LR3-Detailed Image 7


    Why Choose Our Peptides?

    • Quality Assured: Sourced from trusted manufacturers with reliable global distribution, ensuring consistency and potency .
    • Holistic Support: Complements weight management programs, metabolic health goals, and sleep apnea treatment plans—addressing root causes for lasting impact .

    • Why Partner with us?


      Quality Assurance:

      Manufactured in GMP-certified facilities with full traceability and regulatory-aligned documentation.

      Flexible Supply:

      Available in multiple formats. Consistent lead times with flexible production capacity.

      Competitive Edge:

      Factory-direct pricing with volume discounts; stable supply chain to meet your market demand.

      Technical Support:

      Full documentation and formulation guidance.

    Shop IGF 1LR3-Detailed Image 8


    Shop IGF 1LR3-Detailed Image 9


    Shop IGF 1LR3-Detailed Image 10



    Items Specifications
    Product NameSelank LL-37
    CAS No. 154947-66-7
    Storage Store in a cool and dry place



    Shipping & Payment Information



    • Global Shipping – US, Europe, Southeast Asia, Middle East, and more

    • Packaging – Vacuum-sealed + discreet outer box 

    • Delivery Time – Approximately 7–20 days depending on region

    • Payment Methods – Bank transfer, USDT, Alipay, WeChat (negotiable)


    Certificates

    Basic Info
    Product Name:

    MOTS-c

    Other Name:

    MOTS-c

    CAS No.:

    1627580-64-6

    Molecular Formula:

    C101H152N28O22S2 • C2HF3O2

    InChIKeys:

    WYTHCOXVWRKRAH-UHFFFAOYSA-N

    Molecular Weight:

    2174.6

    Exact Mass:

    2174.1110958

    Categories:

    Polypeptide

    Characteristics
  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    Room 3043, 3rd Floor, Building 15, No. 185 Xinda Road, Wanghailou Street, Hebei District, Tianjin

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    11-50

    Year of Establishment:

    2025

    Certifications:

    .,证书


       公司简介  


    Company Profile
    We are a modern, rapidly growing biopharmaceutical company specializing in the production of pharmaceuticals, biologics, and nutraceuticals. We offer internationally leading healthcare products, chemicals, electronics, and mining machinery. Our innovative, full-cycle production facilities fully comply with GMP and ISO standards. We are committed to providing high-quality, affordable, innovative products to prevent disease and support healthier lifestyles. We optimize scientific innovation and production technologies to enable our customers to better serve their consumers. We provide a comprehensive range of services and products for the pharmaceutical and nutraceutical industries, from custom development and production of active ingredients to finished dosage forms. With our scale and resources, we offer our customers one-stop solutions to help people get, feel, and stay well.
    
  • Inquiry History
    128 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Mots-C CAS 1627580-64-6

    5 G Apr 26, 2026
    United States

    MOTS-c (Human) Acetate 98% Powder 1627580-64-6 Senwayer

    1 G Sep 7, 2023
    United States

    Bodygrowth Peptides CAS 1627580-64-6 MOTS-c (Human) Acetate peptides powder

    1 G Feb 23, 2026
    United States

    MOTS-c (Human) Acetate peptides powder

    1 G Mar 12, 2026
    Brazil

    MOTS-c 10mg Peptide Raw Material High Purity

    10 PCS Feb 17, 2026
    United States

    Mots-C

    1 KG Sep 12, 2025
    United Kingdom

    mots-c

    15 MG Aug 3, 2026
    United States

    Mots c

    10 MG Jul 23, 2026
    United States

    MOTS-c

    20 MG Jul 21, 2026
    Azerbaijan

    Mots-c

    5 G Jun 25, 2026
    United States

    MOTS-c

    500 MT Jun 22, 2026
    United States

    Mots-c

    1 MT Jun 16, 2026
    Australia

    MOTS-c 50mg

    30 PCS May 25, 2026
    United States

    Mots C

    4000 MG May 20, 2026
    China

    Mots-C

    10000 MT May 19, 2026
    Brazil

    most-C

    1 KG May 12, 2026
    Canada

    Mots-c

    1 KG Apr 23, 2026
    Greece

    MOTS-C

    10 G Apr 14, 2026
    Pakistan

    MOTS-C

    10 PCS Apr 6, 2026
    United States

    Mots-C

    10 MT Apr 4, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.