Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 bulk peptide supplier factory price high purity from china
LL37 bulk peptide supplier factory price high purity from china buy - large image1
LL37 bulk peptide supplier factory price high purity from china buy - image1
LL37 bulk peptide supplier factory price high purity from china buy - image2
LL37 bulk peptide supplier factory price high purity from china buy - image3
LL37 bulk peptide supplier factory price high purity from china buy - image4
LL37 bulk peptide supplier factory price high purity from china buy - image5
LL37 bulk peptide supplier factory price high purity from china buy - image6

LL37 bulk peptide supplier factory price high purity from china

1 Inquiries

Unit Price:

$1/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shanghai

Brand:

JL

Packaging:

10 Vials per box

Price valid (until):

2027-05-28

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    WhatsApp:+85293764717          

    WhatsApp:+85293764717

    Discover a premium-grade solution for modern weight management formulations with our customizable peptide freeze-dried powder, designed for global buyers seeking quality, flexibility, and sustainability. This advanced cosmetic raw material is manufactured under strict quality control standards and presented in sterile plastic vials to ensure purity, stability, and ease of handling throughout transportation and application processes.


    Our peptide powder is available in multiple dosage options—5mg —allowing brands, laboratories, and distributors to tailor their product lines according to specific market demands. Whether you are developing innovative cosmetic formulations, research-based solutions, or wellness-oriented product lines, this customizable range provides unmatched versatility. Each vial contains precisely measured, freeze-dried peptide powder that maintains structural integrity and potency, ensuring consistent performance across batches.


    One of the key advantages of this product is its freeze-dried (lyophilized) form, which enhances shelf life and simplifies storage requirements. The process preserves the peptide’s bioactive properties, making it ideal for long-distance shipping and global distribution. The sterile plastic vials are lightweight, durable, and resistant to breakage, offering a safer and more cost-effective alternative to traditional glass packaging. This design also aligns with eco-friendly initiatives by reducing material waste and carbon footprint during logistics.


    Customization is at the core of our offering. We support private labeling, OEM/ODM services, and flexible packaging solutions to help your brand stand out in competitive markets. From logo printing to tailored packaging designs, we enable you to create a unique identity that resonates with your target audience. Our production team works closely with clients to ensure specifications are met with precision, from peptide concentration to packaging aesthetics.


    This peptide raw material is widely used in cosmetic and research applications focused on body contouring, metabolism support, and advanced skincare innovation. Its high purity and reliable quality make it a preferred choice for professionals seeking dependable ingredients for formulation development.


    We prioritize sustainability and global usability. Our eco-conscious packaging and efficient production processes are designed to meet international standards, making this product suitable for export to diverse markets worldwide. Each batch undergoes rigorous testing to ensure compliance with quality benchmarks, providing buyers with confidence and consistency.


    Partner with us to access a reliable supply of high-quality peptide freeze-dried powder, backed by customization options and global logistics support. Whether you are expanding your product portfolio or entering new markets, this versatile and eco-friendly solution is designed to meet your business needs with efficiency and professionalism.

    Shop -B12 factory direct sales wholesale price safe delivery from china-Detailed Image 1


    Shop -B12 factory direct sales wholesale price safe delivery from china-Detailed Image 2

    Shop Highly effective weight loss slimming Semaglutide peptide powder 20mg-Detailed Image 2

    Shop Top grade factory price Trizepatide, semaglutide and retraglutide in stock-Detailed Image 4

    Shop High purity white powder peptide RETA with door to door delivery  Peptide polypeptide lyophilized powder-Detailed Image 5

    Shop -Cortagen safe delivery with door to door  china peptide factory-Detailed Image 6

    Shop -Cortagen safe delivery with door to door  china peptide factory-Detailed Image 7




     

    About US

     


    We are dedicated to providing high-quality peptides at affordable prices. Our products are produced quickly and safely. And our products have been spread across Europe, South America, North America, Southeast Asia, Africa and more countries in the world.

    Our goal is to survive by quality and develop by reputation. We adhere to rigorous quality control standards, ensuring high purity and accurate peptide sequences. 

    Constantly strive for high quality products, competitive prices, professional support, effective team, cooperative and honest cooperation, good after-sales work. Meet the new and old customers to buy.

    Our Service:

    1.Cooperate with research institutions, we strictly control the process from raw material to finished product.

    2.The customer comes first, we provide reasonable price, high quality product and prompt shipment.

    3.We can send the goods to your delivery address directly. It is relatively safe and fast.

    4.Quick and clear response to customers questions.

    5.We could make our price discount if you place a substantial order with us.

    Shop Tirzepatide CAS 2023788-19-2 15mg Vial Minimum order quantity In stock High purity Low price-Detailed Image 7

    Shop Top grade factory price Trizepatide, semaglutide and retraglutide in stock-Detailed Image 8

    Shop Tirzepatide CAS 2023788-19-2 15mg Vial Minimum order quantity In stock High purity Low price-Detailed Image 8


     

    Package & Delivery

     


    Product Packing: 5mg 

    Shipping Condition:Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    When storing peptides, remember to:

    • Store peptide in a cold, dry, dark place

    • Avoid repeated freezing and thawing of peptide

    • Avoid overexposure to the air • Avoid light exposure

    • Avoid storing peptides in solution long term

    

    Shop Tirzepatide CAS 2023788-19-2 15mg Vial Minimum order quantity In stock High purity Low price-Detailed Image 10

       FAQ 

    Q1: Have your Product Quality been Approved by Third Party Lab?

    A: Yes, All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China. So you will be assured with Good Quality if you choose us.

    Q2: How to cooperate with us?

    You can contact us for cooperation through the website contact information, or contact with the salesmen in our company. We will connect you about the specific detail via email. 

    Q3: Is there any discount?

    A: Yes, for larger quantity, we always support with better price. 

    Q4: How long does it take to the goods arrived?

    A:It is Depending on your location.
    For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, EMS.
    For mass order, please allow 5-8 days by Air, 20-35 days by Sea.

    Q5: Do you have any reshipment policy ?

    We have good after-sale service and re-shipment policy if the parcel  lose.
    Our long association with  our clients has brought great benefits.
    We always take the upmost care in the packaging of our products .
    Our clients will confirm this as even they struggle to find them without help at times.
    But in spite of our best efforts it is still possible  will seize a small number of packages.
    In this circumstance we promise reship free  to establish  long term relationship.

    Items Specifications
    product LL37
    specification 5mg 
    purity 99%
    appearance powder

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide

    Location:

    zhejiangshengjinhuashiyiwushijiangdongjiedaodongnanlu656hao

    Average lead Time:

    15

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    Jielu Trading focuses on the global cross‑border supply chain of high‑end peptide raw materials. Rooted in cutting‑edge biotechnology, we specialize in the selection, quality control, trade and globalized services of peptide products.

    Adhering to strict quality standards and raw material traceability systems, we provide high‑purity and stable peptide raw materials as well as integrated supply‑chain solutions for scientific research, health care and medical aesthetics industries with standardized production and complete compliance qualifications.

    Guided by our brand philosophy With Peptide Power, Integrity Leads Far, Empowering the World, Jielu builds a stable and efficient global trade network with craftsmanship, integrity and global vision. We strive to be an influential benchmark service provider in the worldwide peptide industry, and create a brighter future with global partners.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.