Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Antioxidant Ingredient > LL-37 for Sale > LL37 Factory direct Peptide Manufacturers Discount price Pure 99%
LL37 Factory direct Peptide Manufacturers Discount price Pure 99% buy - large image1
LL37 Factory direct Peptide Manufacturers Discount price Pure 99% buy - image1
LL37 Factory direct Peptide Manufacturers Discount price Pure 99% buy - image2
LL37 Factory direct Peptide Manufacturers Discount price Pure 99% buy - image3
LL37 Factory direct Peptide Manufacturers Discount price Pure 99% buy - image4
LL37 Factory direct Peptide Manufacturers Discount price Pure 99% buy - image5
LL37 Factory direct Peptide Manufacturers Discount price Pure 99% buy - image6

LL37 Factory direct Peptide Manufacturers Discount price Pure 99%

TDS 3 Inquiries

Unit Price:

$20-25/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Research Grade

Content:

99.9%

Port:

GUANGZHOU

Brand:

HF

Packaging:

5mg/vial

Price valid (until):

2027-01-14

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


       Product Detail   


    Shop KissPeptin-10 99.9 purity Multi peptides Manufacturer Supply Professional-grade Fine workmanship-Detailed Image 1

    Sales Manager: Mily

    WhatsApp: +86 19943528714
    +852 98534126

    Email: sales04@yw-jl.c

    Shop KissPeptin-10 99.9 purity Multi peptides Manufacturer Supply Professional-grade Fine workmanship-Detailed Image 2

    Items Specifications
    CAS 154947-66-7
    Appearance White Powder
    Purity (HPLC) 99.9%

    Shop KissPeptin-10 99.9 purity Multi peptides Manufacturer Supply Professional-grade Fine workmanship-Detailed Image 3

    Q1: Are you a supplier or a manufacturer?
    A: We are both a supplier and a manufacturer.
    Q2: How do you make the delivery?
    A: We have established stable cooperative relationships with DHL, TNT, UPS, FedEx, EMS, China Post Air Express, etc. For container transportation, we can arrange for sea shipping; you can also choose your own freight forwarder.
    Q3: What payment methods do you accept?
    A: We accept Alipay Bank Account USDT.
    Q4: How about the after-sales service?
    A: We offer high-quality products and guarantee 100% safe delivery.
    Q5: How do you ensure product quality?
    A: We will send you the analysis report (COA) of the sample to confirm the quality.
    Q6: How can we verify the quality of the products before placing an order?
    A: For some products, free samples are available. You only need to bear the shipping cost or arrange for a courier to pick them up. You can also provide the product specifications and requirements, and we will produce them accordingly.
    Q7: Are there any discount offers?
    A: Yes, the larger the order quantity, the more favorable the price will be.

    Shop Melanotan II Factory Supply Freeze dried powder Multi peptides 99.9  purity-Detailed Image 4


      Company Profile  


    Shop KissPeptin-10 99.9 purity Multi peptides Manufacturer Supply Professional-grade Fine workmanship-Detailed Image 4

    Tianjin Huifeng Technology Co., Ltd. is a company specializing in the production of various peptide products and chemical raw materials. We have a professional R&D team and an efficient and reliable logistics team to ensure that you can receive high-quality products safely and on time. Our customers are located in the United States, Europe, Japan, South Korea, India, and other regions. Most of our main products are in stock and can be shipped immediately. Please inform us of your specific quantity requirements, and we will provide you with the most competitive prices. Welcome to contact us at any time for more information.
    We offer a wide range of peptide products, which are widely used in life science research, drug development, cosmetics, anti-aging medicine, and functional health supplements. We guarantee excellent product quality and competitive prices. Customers who have ordered our peptide products have always given high evaluations. We sincerely welcome reliable buyers from all over the world to contact us and negotiate business cooperation for peptide products.

    Shop KissPeptin-10 99.9 purity Multi peptides Manufacturer Supply Professional-grade Fine workmanship-Detailed Image 5

    1. Outstanding Product Quality
    Product quality is the foundation of our business. Our peptide compounds are synthesized using the solid-phase peptide synthesis method (SPPS), purified by high-performance liquid chromatography (HPLC), and verified by mass spectrometry (MS).
    Each batch of products comes with an analysis certificate (COA), which contains key data: ••• Purity (HPLC) • Molecular weight (MS) • • • Moisture content • • • Residual solvents • • Microbial limits (if applicable).
    For customers with stricter regulatory requirements, we can also provide third-party testing reports, endotoxin (LAL) data, and stability study documents.
    2. Customized Services and R&D Support
    We provide flexible customized synthesis services and support from an experienced R&D team. Whether you need a new peptide sequence, cosmetic-grade purity, or modified molecules (such as PEGylation or acetylation), we can deliver high-quality products on time. Our services include:
    •• Custom peptide synthesis (milligram to kilogram level)
    ••• Peptide modification and labeling
    •• Small molecule synthesis
    • Project-based R&D and large-scale production
    We work closely with our clients to ensure technical feasibility, rapid delivery, and cost control throughout the entire development cycle.
    3. Diverse product portfolio
    We offer a wide range of products that are continuously expanding:
    ••• Peptides: GLP-1 analogues (such as sitagliptin, tazapetide, retactide, etc.), cosmetic-grade peptides (such as acetyl hexapeptide-8, Matrixyl, etc.), anti-aging peptides, and research-grade peptides.
    •• Small molecule compounds: Cognitive enhancers, NAD+ precursors/promoters (such as NMN, NR, NADH) and intermediates.
    • Biochemical products: Amino acid derivatives, enzyme cofactors, and custom reagents.
    To meet the constantly changing market demands, we regularly introduce new products. At the same time, we also provide batch pre-order services for customers with continuous or seasonal demands.

    Shop KissPeptin-10 99.9 purity Multi peptides Manufacturer Supply Professional-grade Fine workmanship-Detailed Image 6 Shop KissPeptin-10 99.9 purity Multi peptides Manufacturer Supply Professional-grade Fine workmanship-Detailed Image 7 Shop KissPeptin-10 99.9 purity Multi peptides Manufacturer Supply Professional-grade Fine workmanship-Detailed Image 8 Shop KissPeptin-10 99.9 purity Multi peptides Manufacturer Supply Professional-grade Fine workmanship-Detailed Image 9 Shop KissPeptin-10 99.9 purity Multi peptides Manufacturer Supply Professional-grade Fine workmanship-Detailed Image 10

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL37 Factory direct Peptide Manufacturers Discount price Pure 99% is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    No. 85, Qingnian Road, Hongqiao District, Tianjin

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    51-100

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.