Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 buy - large image1
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 buy - image1
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 buy - image2
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 buy - image3
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 buy - image4
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 buy - image5
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 buy - image6

Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37

COA TDS 3 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GuangZhou

Brand:

MingHeng

Packaging:

5mg/vial,10 vials/box

Price valid (until):

2026-01-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Agrochemicals,Chemical Pesticides,Peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Sales manager:Emily
    whatsapp:+852 9720 1305
    Email:emily@xtmingheng.com

    sincerely look forward to your inquiries about our products.


       Product Detail  


    Items Specifications

    Product Name   

     LL-37

    CAS 

    154947-66-7
    Molecular Formula C205H340N60O53
    color White
    Form Solid freeze-dried powder
    Storage condition  -20°C
    Purity     99%  
     Packaging Bottle, Can, Drum, Plastic Container, Vacuum Packet (According to customers' requirements)  
     Trademark Customzied accepted   


      What is it?   


    LL-37, fully named human antimicrobial peptide LL-37, is an innate "intelligent defense master" within our body. It serves not only as a core warrior in the innate immune system but also plays multiple roles as an alarm signal, conductor, and repair engineer. As the only antimicrobial peptide derived from the cathelicidin family in humans, it is rapidly produced by epithelial and immune cells in response to infection or injury. With its unique cationic amphipathic α-helical structure, it acts like a "molecular key" that accurately recognizes and physically disrupts the cell membranes of negatively charged microbes (including bacteria, fungi, and enveloped viruses), leading to rapid pathogen destruction. Since its mechanism relies on physical attack rather than target inhibition, it hardly induces drug resistance. Yet its marvel extends far beyond direct antimicrobial action—it functions as the "strategic hub" of the immune system, recruiting reinforcements like neutrophils through chemotaxis and meticulously regulating the initiation and resolution of inflammation to prevent excessive immune damage to host tissues. Simultaneously, it acts as an "ignition engine" for tissue repair, promoting epithelial cell migration, angiogenesis, and extracellular matrix remodeling to accelerate wound healing. From combating drug-resistant infections and treating chronic refractory wounds to modulating autoimmune inflammation such as in psoriasis, and even serving as a functional skincare ingredient for barrier repair, LL-37 demonstrates tremendous potential spanning basic immunology to clinical translation, standing as a vital molecular bridge connecting the body’s defense, balance, and regenerative wisdom.


    Uses and Functions  


    Its primary roles can be summarized in three key aspects:

    1. Rapid Response Unit

    When bacteria, fungi, or enveloped viruses invade, LL-37 acts like a “natural antibiotic,” directly attacking and physically destroying or inhibiting these pathogens with speed.

    2. Alarm Signal & Commander

    Upon detecting pathogens or tissue damage, LL-37 serves as an “alarm signal,” releasing chemical cues to recruit more immune cells (like neutrophils and macrophages) to the “battlefield.” Simultaneously, it acts like a “field commander,” intelligently modulating the intensity and duration of the inflammatory response—effectively eliminating threats while preventing excessive immune reactions that could harm the body’s own tissues.

    3. Repair Engineer

    Once the battle subsides, LL-37’s work continues. It transitions into the role of a “repair foreman,” promoting the migration and proliferation of skin cells, stimulating the formation of new blood vessels, and actively clearing the “battlefield” to accelerate wound healing and tissue regeneration.


      Mechanism of Action


    1. Physical Breach (Against Microbes)

    The LL-37 molecule carries a positive charge, while the cell membranes of bacteria and fungi carry a negative charge. They attract each other like magnets. Once close, LL-37 inserts itself and disrupts the microbial membrane structure, effectively “punching holes” in it. This causes the microbe’s internal contents to leak out, leading to rapid death. This mode of attacking the overall membrane structure makes it very difficult for bacteria to develop resistance, unlike with conventional antibiotics.

    2. Sending Signals (Commanding the Immune System)

    LL-37 itself is a crucial signaling molecule. When released at sites of infection or injury, it acts like a “flare” or a “homing beacon,” guiding other immune cells. It tells immune cells “where the enemy is,” instructs them on how to coordinate the attack, and signals when to stop fighting and begin repair work.

    3. Promoting Growth (Repairing Damaged Tissue)

    During the repair phase, LL-37 “communicates” with cells like skin cells and vascular endothelial cells, activating their internal growth signaling pathways. This is akin to giving repair cells the “green light,” encouraging them to migrate faster to the wound site, proliferate, and form new blood vessel networks, thereby efficiently completing the reconstruction task.


      Benefits


    • Broad-Spectrum and Potent: Effective against a wide range of common pathogens, including some drug-resistant bacteria.

    • Low Resistance Risk: Its unique physical mode of action significantly reduces the risk of pathogens developing resistance.

    • Intelligent Modulation: Not only initiates immune attack but also precisely controls the level of inflammation, preventing excessive immune damage.

    • Promotes Healing: Seamlessly bridges the “defense” and “repair” processes, making it an ideal promoter of tissue regeneration.

    • Naturally Safe: As an endogenous substance, it has high biocompatibility and typically does not cause strong side effects or allergic reactions.

    Shop Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37-Detailed Image 1

    Shop Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37-Detailed Image 2

    Shop Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37-Detailed Image 3



      Company Profile   


    Shop Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37-Detailed Image 4

    Shop Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37-Detailed Image 5

    Shop Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37-Detailed Image 6

    Shop Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37-Detailed Image 7

    Shop Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37-Detailed Image 8


    Our Advantages  


    Shop Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37-Detailed Image 9


      Packaging Process  


    Shop Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37-Detailed Image 10

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 Certificates 2 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Agrochemicals,Chemical Pesticides,Peptides

    Location:

    haikou

    Payment Terms:

    L/C,O/A,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    51-100

    Year of Establishment:

    2024

    Certifications:

    coa

    Company Profile


    High-Quality Peptides: Our company specializes in premium-grade peptides, ensuring the highest standards of purity and efficacy. Each product undergoes rigorous testing to guarantee superior quality and performance.
    Cutting-Edge Technology: We leverage the latest advancements in peptide synthesis and production technology. Our state-of-the-art facilities and innovative processes enable us to deliver peptides with exceptional precision and consistency.
    Custom Solutions: We offer tailored peptide solutions to meet the specific needs of our clients. Whether you require bespoke formulations or custom quantities, our experienced team is dedicated to providing personalized support and solutions.
    Extensive Expertise: With years of experience in the peptide industry, our team of experts is well-versed in the complexities of peptide development and applications. We are committed to providing insightful guidance and technical support to help you achieve your goals.
    Comprehensive Product Range : Our diverse portfolio of peptide products covers a wide range of applications, including research, pharmaceutical development, and cosmetic formulations. This allows us to cater to various industries and meet different customer needs.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.