Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder
LL37 | US Warehouse   | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - large image1
LL37 | US Warehouse   | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image1
LL37 | US Warehouse   | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image2
LL37 | US Warehouse   | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image3
LL37 | US Warehouse   | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image4
LL37 | US Warehouse   | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image5
LL37 | US Warehouse   | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image6

LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder

TDS 3 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharma Grade / Research Grade

Content:

99%

Port:

GUANGZHOU

Brand:

HF

Packaging:

5 mg/vial

Price valid (until):

2026-08-08

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    NAME: ANNA
    WHATSAPP:+8619933210924
                       +852 5504 3622
    EMAIL:sales02@yw-jl.cn
    Welcome to concult

    Manufacturer advantages

    —— Basic Introduction ——


    Name: LL37
    CAS#: 597565-74-7
    Molecular Formula: C209H317N53O43
    Molecular Weight: 4516.38
    Sequence: [LL-37, 37 aa]
    Appearance: White Powder
    Purity (HPLC): ≥99.0%
    Single Impurity (HPLC): ≤1.0%
    Moisture Content (Karl Fischer): ≤10.0%
    Peptide Content: ≥80.0%
    Storage: Store at -20℃ degrees Celsius in a dry and cool place.
    Storage Condition: Store at -20°C
    Solubility in DMSO: 3mg/mL

    What is LL37 used for?

    LL37 is a naturally derived human antimicrobial and immunomodulatory peptide. It supports bodily defense regulation, relieves abnormal inflammatory responses, and promotes skin and tissue repair. It is commonly applied in immune defense research, anti-inflammation studies and daily skin and physiological conditioning.

    What does LL37 do to your body?

    LL37 regulates immune responses and inhibits excessive inflammatory activity in the body. It enhances endogenous defense capacity, accelerates damaged tissue repair, and balances immune cell activity. It effectively alleviates persistent low-grade inflammation and improves weakened physiological defense states.

    What effect can you get with LL37?

    Long-term standardized use of LL37 stabilizes immune and inflammatory balance. It relieves inflammation-induced sub-health and poor tissue recovery, improving overall physiological stability. Featuring mild bionic regulation, it delivers safer, gentler and more reliable defense conditioning than traditional regulatory ingredients.
    Shop LL37 | US Warehouse   | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 1
    Shop LL37 | US Warehouse   | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 2


    ——Peptide Storage Guidelines——

    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements

    Shop GMP Certified Peptide Factory Melanotan 2 Acetate MT-210mg Lyophilized Powder for Export-Detailed Image 3


     ——FAQ——

    Q1: Are you a supplier or a manufacturer?
    A: We are both a supplier and a manufacturer.
    Q2: How do you make the delivery?
    A: We have established stable cooperative relationships with DHL, TNT, UPS, FedEx, EMS, China Post Air Express, etc. For container transportation, we can arrange for sea shipping; you can also choose your own freight forwarder.
    Q3: What payment methods do you accept?
    A: We accept Bitcoin and USDT.
    Q4: How about the after-sales service?
    A: We offer high-quality products and guarantee 100% safe delivery.
    Q5: How do you ensure product quality?
    A: We will send you the analysis report (COA) of the sample to confirm the quality.
    Q6: How can we verify the quality of the products before placing an order?
    A: For some products, free samples are available. You only need to bear the shipping cost or arrange for a courier to pick them up. You can also provide the product specifications and requirements, and we will produce them accordingly.
    Q7: Are there any discount offers?
    A: Yes, the larger the order quantity, the more favorable the price will be.
     

    ——Product Description —— 

    
    LL37 exhibits outstanding efficacy in immune modulation, inflammatory balance regulation and tissue repair protection compared with common bioactive peptide ingredients. As a high-activity endogenous defense peptide, it has high binding affinity for human immune and tissue receptors. This unique regulatory mechanism effectively relieves persistent inflammation, immune imbalance and slow tissue repair without causing physiological dependence or adverse side effects. Relevant pharmacological studies confirm that LL37 perfectly mimics natural human defense regulatory activity, safely and efficiently balancing immune responses, inhibiting abnormal inflammation and stabilizing bodily physiological functions. It is widely used in immune regulation research, tissue conditioning research and daily body regulation, providing a safe and natural alternative to traditional physiological adjustment methods.


    ——Company Profile——


     Tianjin Huifeng Technology Co., Ltd. is a company specializing in the production of various peptide products and chemical raw materials. We have a professional R&D team and an efficient and reliable logistics team to ensure that you can receive high-quality products safely and on time. Our customers are located in the United States, Europe, Japan, South Korea, India, and other regions. Most of our main products are in stock and can be shipped immediately. Please inform us of your specific quantity requirements, and we will provide you with the most competitive prices. Welcome to contact us at any time for more information.
    We offer a wide range of peptide products, which are widely used in life science research, drug development, cosmetics, anti-aging medicine, and functional health supplements. We guarantee excellent product quality and competitive prices. Customers who have ordered our peptide products have always given high evaluations. We sincerely welcome reliable buyers from all over the world to contact us and negotiate business cooperation for peptide products. 1. Outstanding Product Quality
    Product quality is the foundation of our business. Our peptide compounds are synthesized using the solid-phase peptide synthesis method (SPPS), purified by high-performance liquid chromatography (HPLC), and verified by mass spectrometry (MS).
    Each batch of products comes with an analysis certificate (COA), which contains key data: ••• Purity (HPLC) • Molecular weight (MS) • • • Moisture content • • • Residual solvents • • Microbial limits (if applicable).
    For customers with stricter regulatory requirements, we can also provide third-party testing reports, endotoxin (LAL) data, and stability study documents. 2. Customized Services and R&D Support
    We provide flexible customized synthesis services and support from an experienced R&D team. Whether you need a new peptide sequence, cosmetic-grade purity, or modified molecules (such as PEGylation or acetylation), we can deliver high-quality products on time. Our services include:
    •• Custom peptide synthesis (milligram to kilogram level)
    ••• Peptide modification and labeling
    •• Small molecule synthesis
    • Project-based R&D and large-scale production
    We work closely with our clients to ensure technical feasibility, rapid delivery, and cost control throughout the entire development cycle. 3. Diverse product portfolio
    We offer a wide range of products that are continuously expanding:
    ••• Peptides: GLP-1 analogues (such as sitagliptin, tazapetide, retactide, etc.), cosmetic-grade peptides (such as acetyl hexapeptide-8, Matrixyl, etc.), anti-aging peptides, and research-grade peptides.
    •• Small molecule compounds: Cognitive enhancers, NAD+ precursors/promoters (such as NMN, NR, NADH) and intermediates.
    • Biochemical products: Amino acid derivatives, enzyme cofactors, and custom reagents.

    Shop GMP Certified Peptide Factory Melanotan 2 Acetate MT-210mg Lyophilized Powder for Export-Detailed Image 4

    Shop GMP Certified Peptide Factory Melanotan 2 Acetate MT-210mg Lyophilized Powder for Export-Detailed Image 5

    Shop GMP Certified Peptide Factory Melanotan 2 Acetate MT-210mg Lyophilized Powder for Export-Detailed Image 6


     





      Shop GMP Certified Peptide Factory Melanotan 2 Acetate MT-210mg Lyophilized Powder for Export-Detailed Image 7 ——Payments ——
    We support payment methods including Alipay, bank cards and USDT
    Shop GMP Certified Peptide Factory Melanotan 2 Acetate MT-210mg Lyophilized Powder for Export-Detailed Image 8
    Shop GMP Certified Peptide Factory Melanotan 2 Acetate MT-210mg Lyophilized Powder for Export-Detailed Image 9

    ——Modes of transport ——
    We offer global shipping via EMS and FedEx with full tracking and secure delivery to all regions worldwide.
    Shop GMP Certified Peptide Factory Melanotan 2 Acetate MT-210mg Lyophilized Powder for Export-Detailed Image 10



    Items Specifications
    CAS number 154947-66-7
    Purity 99%
    Appearance White powder
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    No. 85, Qingnian Road, Hongqiao District, Tianjin

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    51-100

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.