| Items | Specifications |
| Product Full Name | Vasoactive Intestinal Peptide (VIP) Synthetic Polypeptide |
| CAS Number | 37221-79-7 |
| Appearance | White loose lyophilized powder, no visible foreign impurities |
| HPLC Purity | ≥98.0% |
| Amino Acid Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN |
| Molecular Weight | 3326.8 Da3326.8 Da |
| Water Content | ≤5.0% |
| Endotoxin Content | ＜1 EU/mg |
| Solubility | Soluble in ultrapure water and pH7.2 PBS buffer |
| Storage Condition | Sealed, light-proof, stored at -20℃ |
| Applicable Scope | For in vitro neurobiology & gastrointestinal cell research only |
Product Basic Profile
Full Product Name: Synthetic Vasoactive Intestinal Peptide VIP CAS Registration Number: 37221-79-7 Physical Appearance: White loose lyophilized powder, no visible foreign particles, no caking or moisture absorption HPLC Purity: ≥98.0%, single impurity peptide ≤1.0%, total impurity peptides ≤2.0% Amino Acid Sequence: [LL-37, 37 aa] Molecular Weight: 3326.8 Da Water Content: ≤5.0% Endotoxin Residue: ＜1 EU/mg Solubility: Completely soluble in ultrapure water and pH7.2 PBS aqueous solution Standard Storage Condition: Sealed, light-shielded, stored at -20℃, valid shelf life 24 months All testing items follow unified industry standards for lab peptide reagents. Each batch is equipped with independent HPLC chromatogram and ESI-MS mass spectrum report to verify molecular weight and purity data one by one, ensuring consistent performance across batches.Gastrointestinal epithelial cell isolated culture research: Build isolated intestinal epithelial cell culture model, study the regulatory effect of VIP peptide on cell secretion function and intestinal barrier related signal pathways. Neuroimmunology basic cell experiment: Complete co-incubation of monocytes, macrophages and nerve cell strains, analyze the regulation of VIP on cellular inflammatory factor secretion and cell chemotaxis. Biomolecular interaction basic research: Carry out co-incubation test of VIP peptide with nucleic acid, protein and lipid biomolecules, detect molecular binding affinity to provide data support for biochemistry academic papers. In vitro cell inflammation injury model construction: Establish LPS-induced cell injury model, observe the protective effect of VIP peptide on damaged isolated cells and explore downstream signal pathway mechanism. Pre-screening of novel regulatory peptide templates: Serve as standard reference peptide for in vitro preliminary screening of new regulatory peptide molecular templates, only limited to isolated strain and cell level testing, not used for pharmaceutical formulation preparation.ong-term storage: Tightly seal glass vials or aluminum foil bags, store at -20℃ away from light and moisture, minimize repeated freeze-thaw cycles to prevent peptide chain hydrolysis and degradation. Temporary storage after opening: Keep tightly sealed at 2–8℃, finish all experimental use within 30 days after opening to avoid moisture absorption and impurity contamination. Dissolution operation suggestion: Prepare fresh peptide solution with sterile ultrapure water or pH7.2 PBS buffer before each experiment, discard residual diluted liquid after single use, do not store diluted peptide solution for long time. Transportation requirement: Avoid direct sunlight and long-time exposure to high temperature environment during whole cold chain transportation.ull panoramic shot of independent VIP lyophilized peptide glass vial English: Complete display of bottle shape and full printed label, plain white lab backgroundMacro close-up of white loose lyophilized powder inside vial English: Show loose porous texture, no caking, moisture absorption or foreign particlesMulti small-specification glass vial comparison display picture English: Show optional mg-level lab trial packaging specifications
ECHEMI Editorial Reference
Vasoactive Intestinal Peptide (VIP) is a highly basic, 28 amino acid neuropeptide released from the intestinal mucosa. It has a wide range of biological actions affecting the cardiovascular, gastrointestinal and respiratory systems and is neuroprotective. It binds to specific receptors (RECEPTORS, VASOACTIVE INTESTINAL PEPTIDE).
Research & Reference Note
VIP Peptide 99% HPLC Lab Research Raw Material is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals
