Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > High Quality Pharmaceutical LL37 Peptide Powder, 5mg CAS Number 154947-66-7, Also Referred to as LL-37
High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37 buy - large image1
High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37 buy - image1
High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37 buy - image2
High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37 buy - image3
High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37 buy - image4
High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37 buy - image5
High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37 buy - image6

High Quality Pharmaceutical LL37 Peptide Powder, 5mg CAS Number 154947-66-7, Also Referred to as LL-37

3 Inquiries

Unit Price:

$47/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HongKong

Brand:

Fire

Packaging:

10vials/box

Price valid (until):

2026-10-15

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide,Skincare

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    LL-37, officially known as human antimicrobial peptide LL-37, is an innate "smart defense commander" within our body. It functions not only as a frontline defender in the innate immune system but also as a signaling alert, immune coordinator, and healing facilitator. As the sole antimicrobial peptide originating from the human cathelicidin family, it is quickly produced by epithelial and immune cells in response to infection or injury. Its distinctive cationic, amphipathic α-helical structure acts like a "molecular key," precisely identifying and physically disrupting the cell membranes of negatively charged pathogens such as bacteria, fungi, and enveloped viruses, leading to swift pathogen elimination. Because its method relies on physical destruction rather than biochemical inhibition, it rarely causes drug resistance.

    Beyond its direct antimicrobial effect, LL-37 functions as a "strategic control center" of the immune response, recruiting immune cells like neutrophils via chemotaxis and carefully regulating inflammation to prevent excessive immune damage to the body's tissues. Simultaneously, it acts as an "activation engine" for tissue repair by promoting epithelial cell migration, new blood vessel formation, and extracellular matrix remodeling, thereby accelerating wound healing. Its capabilities extend from fighting antibiotic-resistant infections and managing stubborn chronic wounds to modulating autoimmune inflammation, such as in psoriasis, and even serving as a beneficial ingredient in skincare formulations aimed at barrier repair. LL-37 showcases remarkable potential across fields from fundamental immunology to clinical applications, serving as a crucial molecular link that supports the body's defense, homeostasis, and regenerative processes.




    Items Specifications
    CAS NO 154947-66-7
    Name LL-37
    Purity 99%


    Whatsapp:+85295916848



    Company Profile


    Overview: 

    We specialize in high-purity peptide products, with each batch produced on dedicated production lines to ensure purity levels exceeding 99%. Our commitment to quality and innovation makes us a trusted partner in the global research, pharmaceutical, and healthcare industries.

     

    Quality Assurance: 

    All our products undergo rigorous testing and quality control under strict management systems. We provide comprehensive documentation including Certificates of Analysis to verify purity, potency, and compliance with international standards, ensuring reliability and transparency for our clients.

     

    Global Reach and Service: 

    With extensive experience and a wide-reaching logistics network, we offer door-to-door delivery and customs clearance assistance for clients worldwide, including the USA, Canada, Australia, Europe, and many other regions. Our dedicated customer service team is committed to providing prompt, responsive support.

     

    Core Values: 

    - Integrity: We operate honestly and transparently, earning the trust of customers, partners, and society. 

    - Quality First: We prioritize safety, effectiveness, and exceeding customer expectations in every product we deliver. 

    - Collaborative Growth: We foster open cooperation with research institutions, universities, and industry partners to create shared value and mutual success. 

    - Innovation and Learning: We continuously explore new scientific frontiers, improve our technologies, and encourage ongoing employee development to stay at the forefront of biotechnology.

     

    Mission: 

    To advance scientific research and healthcare innovation worldwide by providing premium-quality peptides, supporting the development of healthier lives and a brighter future.

     

    FAQ

    1 What types of peptides do you manufacture?

    We specialize in a variety of high-purity peptides, including custom peptides, research-grade peptides, cosmetic peptides, and peptide lyophilized powders and raw materials for pharmaceutical applications.

    2 What is the typical purity of your peptides?

    Our peptides are typically 99% pure, and we provide detailed COA (Certificate of Analysis).

    3 What if I need technical support after purchasing?

    Our technical and sales support team are always here to answer any questions you may have before or after your purchase. Please contact us via WhatsApp or email or form, we will usually respond within 12 hours.

    4 Do you ship internationally?

    Yes, we ship to over 35 countries and regions worldwide and provide full order tracking. If you have special shipping requirements, please let us know in advance.

    5 What payment methods do you accept?

    We support multiple secure payment methods, including:BTC/ETH/USDT/USDC/Alipay/etc.

    6 How long does it take to process and ship my order?

    Standard peptides: We will send out the goods within three days after receiving your payment, and the estimated delivery time is 5~15 days.

      Shop High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37-Detailed Image 1 Shop High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37-Detailed Image 2 Shop High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37-Detailed Image 3 Shop High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37-Detailed Image 4 Shop High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37-Detailed Image 5 Shop High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37-Detailed Image 6 Shop High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37-Detailed Image 7 Shop High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37-Detailed Image 8 Shop High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37-Detailed Image 9 Shop High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37-Detailed Image 10 Shop High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37-Detailed Image 11 Shop High Quality Pharmaceutical LL37 Peptide Powder, 5mg  CAS Number 154947-66-7, Also Referred to as LL-37-Detailed Image 12

    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    High Quality Pharmaceutical LL37 Peptide Powder, 5mg CAS Number 154947-66-7, Also Referred to as LL-37 is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide,Skincare

    Location:

    Room 801, T095, No. 169 Haibin Road, Nansha Street, Nansha District, Guangzhou City

    Average lead Time:

    365

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    11-50

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.