Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > NP810SNAP-8 Large quantity discounts, factory direct sales, purity 99.9%
NP810SNAP-8 Large quantity discounts, factory direct sales, purity 99.9% buy - large image1
NP810SNAP-8 Large quantity discounts, factory direct sales, purity 99.9% buy - image1
NP810SNAP-8 Large quantity discounts, factory direct sales, purity 99.9% buy - image2
NP810SNAP-8 Large quantity discounts, factory direct sales, purity 99.9% buy - image3
NP810SNAP-8 Large quantity discounts, factory direct sales, purity 99.9% buy - image4
NP810SNAP-8 Large quantity discounts, factory direct sales, purity 99.9% buy - image5
NP810SNAP-8 Large quantity discounts, factory direct sales, purity 99.9% buy - image6

NP810SNAP-8 Large quantity discounts, factory direct sales, purity 99.9%

TDS 3 Inquiries

Unit Price:

$1-1.2/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.9%

Port:

SHEN ZHEN

Brand:

customization

Packaging:

10 pieces per box

Price valid (until):

2026-10-15

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

polypeptide,GHK-CU,NAD+,Tirzepatide,GLutathione

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Whatsapp:+85265524367

    I. Core Mechanism: Inhibiting SNAP-25 protein, relaxing facial muscle contractions
    The release of neurotransmitters at the neuromuscular junction requires the participation of SNAP-25 protein. NP810 competitively binds and downregulates SNAP-25 expression, reducing acetylcholine release, gently relaxing expression muscles, and fundamentally blocking the formation of dynamic lines such as frown lines, raised eyes, and smile lines. It has no side effects of botulinum toxin-induced muscle stiffness and is mild and reversible.
    II. Core Effects of External Skin Application (Effective, Clinically Verified)
    1. Alleviate dynamic facial lines, smooth the skin
    Reduce forehead lines, square eyebrows, crow's feet around the eyes, and superficial laugh lines in the jowls. Persistently applying it can reduce the depth and length of lines, prevent fine lines from deepening into deep wrinkles.
    Relax tense chewing muscles and orbicularis oculi muscles, improve facial tension and stiffness, visually lift the contour, and weaken the aggravation of wrinkles caused by relaxation.
    Distinguish from ordinary moisturizing peptides: Only target movement-related wrinkles. For static dry lines, it needs to be combined with collagen peptides and hyaluronic acid for coordinated improvement.
    2. Promote collagen and elastic fiber synthesis, tighten and anti-aging
    Stimulate the activity of dermal fibroblasts, increase the secretion of type I and III collagen, elastin, and thicken the dermis layer, improve facial relaxation and slight sagging of the lower jaw.
    Inhibit matrix metalloproteinase MMP, reduce collagen breakdown and loss, delay premature skin aging and relaxation.
    3. Repair the skin barrier, enhance moisture and luster
    Upregulate the expression of sialoprotein and guanidyl protein, strengthen the keratin barrier, improve dryness, peeling, roughness, and sensitive redness; reduce skin stress inflammation induced by external stimuli.
    Enhance the water retention capacity of the stratum corneum, long-term improve dryness and dullness, brighten the skin tone, and reduce mild inflammatory acne marks.
    4. Anti-inflammatory and soothing, alleviate light damage
    Downregulate skin pro-inflammatory factors TNF-α and IL-6, relieve heat, redness, sensitivity, and itching caused by ultraviolet rays and external stimuli.
    Remove free radicals in the epidermis, reduce photoaging damage, delay the formation of sunspots and fine lines, and enhance anti-aging effect by combining with sunscreen.
    III. Limitations and Weak Auxiliary Effects of Oral NP810 (No Significant Clinical Effects)
    The intestinal peptidase and gastric acid will rapidly hydrolyze the complete peptide chain of NP810, and the complete active molecules are almost unable to enter the bloodstream and reach the facial skin. Oral administration only decomposes into free amino acids, without the core effects of muscle relaxation and line reduction.
    It can only be used as an ordinary amino acid nutrient, providing weak assistance to the synthesis of collagen throughout the body, unable to replace external line reduction and anti-aging effects, and without fat loss, muscle growth, nerve repair, immune regulation, or internal organ maintenance effects.
    IV. Additional Benefits of External Skin Care
    Gentle and non-irritating, does not block all neural signals, will not cause facial stiffness or unnatural expressions, suitable for long-term daily maintenance; sensitive skin, young mature skin, and mature skin can all use it.
    Combined with vitamin C, glutathione, hyaluronic acid, copper peptides can enhance brightening, anti-wrinkle, and moisturizing effects.
    Reduce tight lines around scars, assist in repairing skin tightness and fine lines after minimally invasive and medical treatments.
    V. NP810 (Snap-8) and Similar Beauty Peptides Differences
    Compare with Argireline (six peptides): NP810 has a longer peptide chain, higher efficiency in inhibiting SNAP-25, stronger effect in alleviating dynamic lines, and more lasting muscle-relaxing effect; six peptides have a higher cost-performance ratio, suitable for basic stability maintenance.
    Compare with FOXO4, Cerebrolysin: They do not have the function of clearing senescent cells and repairing brain nerves, are limited to local anti-wrinkle in the epidermis and dermis.
    Compare with KPV, LL37 anti-inflammatory peptides: The core of NP810 is muscle relaxation and line reduction, anti-inflammatory is only an additional effect; KPV focuses on strong anti-inflammatory throughout the body / skin, without muscle-relaxing and line-reducing effects.

    Shop MT10-Detailed Image 1

    Shop MT10-Detailed Image 2 Shop MT10-Detailed Image 3

    Shop MT10-Detailed Image 4 Shop MT10-Detailed Image 5 Shop MT10-Detailed Image 6 Shop MT10-Detailed Image 7

    Shop MT10-Detailed Image 8 Shop MT10-Detailed Image 9

    Shop MT10-Detailed Image 10 Shop MT10-Detailed Image 11 Shop MT10-Detailed Image 12 Shop MT10-Detailed Image 13

    Hazard Identification

    Classification of the substance or mixture

    no data available

    GHS label elements, including precautionary statements

    Pictogram(s) no data available
    Signal word

    no data available

    Hazard statement(s)

    no data available

    Precautionary statement(s)
    Prevention

    no data available

    Response

    no data available

    Storage

    no data available

    Disposal

    no data available

    Other hazards which do not result in classification

    no data available

    Shop MT10-Detailed Image 14
    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

    Items Specifications
    Product Name cerebrolysin
    Purity 99.9%
    Storage Condition Seal and store in cool dry place
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates
    • NP810SNAP-8 Large quantity discounts, factory direct sales, purity 99.9% Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    polypeptide,GHK-CU,NAD+,Tirzepatide,GLutathione

    Location:

    Room 5003, 5/F, Lee Yu Centre, 45 Hoi Yuen Road, Kwun Tong, Hong Kong

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.