Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > 3710| LL-37 Peptide Powder 5mg Direct from Manufacturer (CAS 154947-66-7) High Quality Peptide Powder Human Cathelicidin Antimicrobial Peptide
3710| LL-37 Peptide Powder 5mg  Direct from Manufacturer (CAS 154947-66-7)  High Quality Peptide Powder  Human Cathelicidin Antimicrobial Peptide buy - large image1
3710| LL-37 Peptide Powder 5mg  Direct from Manufacturer (CAS 154947-66-7)  High Quality Peptide Powder  Human Cathelicidin Antimicrobial Peptide buy - image1
3710| LL-37 Peptide Powder 5mg  Direct from Manufacturer (CAS 154947-66-7)  High Quality Peptide Powder  Human Cathelicidin Antimicrobial Peptide buy - image2
3710| LL-37 Peptide Powder 5mg  Direct from Manufacturer (CAS 154947-66-7)  High Quality Peptide Powder  Human Cathelicidin Antimicrobial Peptide buy - image3
3710| LL-37 Peptide Powder 5mg  Direct from Manufacturer (CAS 154947-66-7)  High Quality Peptide Powder  Human Cathelicidin Antimicrobial Peptide buy - image4
3710| LL-37 Peptide Powder 5mg  Direct from Manufacturer (CAS 154947-66-7)  High Quality Peptide Powder  Human Cathelicidin Antimicrobial Peptide buy - image5
3710| LL-37 Peptide Powder 5mg  Direct from Manufacturer (CAS 154947-66-7)  High Quality Peptide Powder  Human Cathelicidin Antimicrobial Peptide buy - image6

3710| LL-37 Peptide Powder 5mg Direct from Manufacturer (CAS 154947-66-7) High Quality Peptide Powder Human Cathelicidin Antimicrobial Peptide

TDS 1 Inquiries

Unit Price:

$153/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.97%

Port:

HK

Brand:

Customization Available

Packaging:

10mg*10vials/box

Price valid (until):

2026-08-17

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,GHK-CU,KPV,MOTS-C,KLOW80

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    contact information:

    Name : Luliya

    Email address : 2429419330@qq.com

    Whatsapp:+1(629)218-8872

    Telegram : +1 317 633 9473@GCDF12

      Product Detail  


    The cathelicidin anti-microbial peptide LL-37 is involved in the reepithelialization of human skin wounds and is lacking in chronic ulcer. LL-37(human) is a cathelicidin-derived peptide with antimicrobial and angiogenic activity. Antimicrobial peptide derivative of human cathelicidin

    Antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. Also triggers apoptosis in colon cancer cells. Cell permeable.


    The human body mainly produces two types of antimicrobial peptides: defensin family peptides and cathelicidin family peptides. Although there are many members of the defensin family of peptides, cathelicidin has only one antimicrobial peptide product, LL-37. LL-37 is the C-terminal cleavage product of cathelicidin peptide Hcap-18, which directly kills bacteria, fungi and viruses.

    CAS:154947-66-7

    Appearance: White Powder

    Purity (HPLC): ≥99.9%

    Single Impurity (HPLC): ≤1.0%

    Sodium Content (HPLC): 5.0%-12.0%

    Moisture Content (Karl Fischer): ≤10.0%

    Peptide Content: ≥80.0%

    Storage: Store at 2-8 degrees Celsius in a dry and cool place.

    Packaging: 5mg,10mg per box

    Intended Use: For scientific research purposes

    Shipping conditions: Shipped at ambient temperature as a non-hazardous chemical. The product is chemically stable and can withstand the transit times (spanning several weeks) associated with standard shipping and customs clearance.
    Storage conditions: Store in a dry place, protected from light; store at 0–4°C for short-term use (days to weeks) and at -20°C for long-term storage (months to years).
    Solubility: To be determined
    Shelf life: >2 years when stored properly
    Pharmaceutical formulation: To be determined
    Stock solution storage: Store at 0–4°C for short-term use (days to weeks) and at -20°C for long-term storage (months).


    CAS number 154947-66-7 Category Peptides
    Quality Refined Purpose Weight Loss
    Bottle Color Transparent MOQ 10 Vials
    Purity 99% Storage Dry Cool Sealed Container
    pecification 10mg Form Lyophilized Powder(Freeze-Dried Powder)

    Peptide

    Peptide products offer diverse functional benefits across multiple scenarios:

    in health management, peptides support metabolic regulation (aiding in blood sugar control and healthy weight management for specific groups) and immune system modulation by enhancing the body's defense responses; 

    in skincare, peptides promote skin barrier repair, boost collagen synthesis to reduce fine lines, and improve skin hydration and elasticity; 

    in sports nutrition, peptides assist in muscle recovery by reducing post-exercise tissue damage and supporting muscle protein synthesis.

    Why Choose Our Peptides?

    • Clinically Relevant: Aligns with global trends in peptide therapeutics, a market projected to reach $83.75B by 2034 .
    • Quality Assured: Sourced from trusted manufacturers with reliable global distribution, ensuring consistency and potency .
    • Holistic Support: Complements weight management programs, metabolic health goals, and sleep apnea treatment plans—addressing root causes for lasting impact .
    • Key Search Terms:

      Prescription peptide for weight loss, obesity peptide therapy, OSA treatment peptides, high-purity weight loss peptides, custom peptides formulations, GLP-1 related peptides,  peptide for weight management, peptide supplements for metabolic health
      Customizable peptide
      Skin care peptide
      Beauty peptide
      Muscle building peptide
      Hair growth peptide
      Weight loss peptide
      Fitness peptide

    company

    Henghong Trading Co., Ltd.LTD was established in 2003 with strong research and development capabilities and superb synthesis technology, as well as advanced quality control measures. Effectively promote the joint venture and cooperation with the major enterprises, manufacturers, with the idea of industrial development to serve the society and the majority of users. We always adhere to the market demand as the orientation, constantly synthesizing new high-tech chemical products and medical intermediates.

    We always put the value of our customers as our top priority, we focus on high quality, competitive price, flexible order quantity, timely delivery. Our products are mainly exported to European countries, the United Kingdom, the United States, Canada and Australia. Our products are widely recognized and trusted by users.

    We have our own delivery line to Canada, USA, UK, Spain, Poland, Netherland, Germany, Russia, Kazakhstan, Ukraine, etc. Door to door without any customs clearance iss




    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss10MG20MG-Detailed Image 1 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss10MG20MG-Detailed Image 2 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss10MG20MG-Detailed Image 3 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss10MG20MG-Detailed Image 4 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss10MG20MG-Detailed Image 5 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss10MG20MG-Detailed Image 6 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss10MG20MG-Detailed Image 7 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss10MG20MG-Detailed Image 8 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss10MG20MG-Detailed Image 9 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss10MG20MG-Detailed Image 10 Shop Cosmetic Powder GhkCU Peptide Peptide  150mg CAS 49557-75-7 Anti-aging Peptides-Detailed Image 2


    Certificates
    • 3710| LL-37 Peptide Powder 5mg  Direct from Manufacturer (CAS 154947-66-7)  High Quality Peptide Powder  Human Cathelicidin Antimicrobial Peptide Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,GHK-CU,KPV,MOTS-C,KLOW80

    Location:

    2nd Floor, Room 0996, No. 963 Tianyuan Road, Tianhe District, Guangzhou

    Average lead Time:

    5

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    51-100

    Year of Establishment:

    2026

                   Company Profile

    Henghong Peptides is a biotechnology enterprise serving global markets, focusing on synthetic peptides. With mature peptide synthesis and purification technology, we have built a comprehensive product portfolio, including KPV, GHK‑CU and other bioactive peptides, as well as BAC Water bacteriostatic solvent, widely used in bioscience research.
    We implement strict quality control. Every batch undergoes purity testing to ensure consistent quality. We offer diversified packaging solutions including bulk raw material and vial filling, supporting small trial orders and mass bulk supply.
    Our products are exported to Europe, America, Southeast Asia and other regions. Supported by mature cross-border logistics, we guarantee efficient delivery. Adhering to integrity and win-win cooperation, we provide stable, cost-effective peptide raw materials and professional supporting services for global partners.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.