Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research
Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research buy - large image1
Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research buy - image1
Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research buy - image2
Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research buy - image3
Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research buy - image4
Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research buy - image5
Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research buy - image6

Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research

TDS 3 Inquiries

Unit Price:

$50/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Reagent Grade

Content:

99%

Port:

Shenzhen City

Brand:

lq

Packaging:

10mg

Price valid (until):

2027-09-05

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,Semaglutide,GHK-CU

  • Product Description

  • Seller Information

  • Inquiry History

  • Description
    Items Specifications
    Product Name LL37 Synthetic Polypeptide
    CAS No 154947-66-7
    Appearance White Lyophilized Powder
    HPLC Purity 99%
    Product Type Biochemical Intermediate
    Specification 5mg/Vial

    Product Overview

    LL37 is a synthetic antimicrobial polypeptide with unique CAS registration number 154947-66-7. It is synthesized via standard solid-phase peptide synthesis technology, purified with multi-gradient reversed-phase high performance liquid chromatography, and processed into lyophilized powder through vacuum freeze-drying. All synthesis, purification, filling and sealing operations are completed in closed dust-free purification workshops. Each batch of finished products undergoes strict HPLC purity detection, impurity analysis, microbial limit test and comprehensive appearance inspection before delivery to guarantee stable batch-to-batch quality consistency.

    Our LL37 lyophilized powder is only supplied as biochemical intermediate raw material for in-vitro academic laboratory scientific research exclusively. This product is strictly prohibited for human injection, oral administration, topical skin application, cosmetic raw material compounding, clinical medication, health care product manufacturing and all other human-oriented commercial application scenarios. All product design, production and packaging schemes are customized to meet experimental demands of university life science laboratories, biomedical research institutes and biochemical R&D enterprises all over the world.

    The finished product is uniform white lyophilized powder with fine texture, no agglomeration, no color difference and no visible foreign impurities. The HPLC purity is stably controlled at 99%. The residual amount of incomplete synthetic peptide fragments, free amino acid raw materials and inorganic salt impurities is kept at an extremely low level, which will not generate extra interference variables in cell antimicrobial experiments, immune cell regulatory pathway exploration and molecular mechanism research, ensuring high accuracy and excellent repeatability of experimental data.

    Core Product Advantages

    1. Excellent Physicochemical Stability Vacuum freeze-drying molding effectively inhibits hydrolysis and peptide chain breakage. Under sealed low-temperature storage conditions, the shelf life can reach up to 24 months. Sealed aluminum flip cap vial packaging can resist moisture erosion, oxidative degradation and ultraviolet radiation during long-distance cross-border transportation, and the inherent physicochemical properties of the product will not deteriorate under conventional transportation environments.
    2. Outstanding Water Solubility The lyophilized powder can be rapidly and completely dissolved in sterile purified water, PBS buffer and all conventional laboratory aqueous solvent systems. No insoluble precipitates or suspended residues appear after dissolution. Researchers can freely prepare experimental solutions with different concentration gradients according to various experimental protocols, which is suitable for cell incubation, liquid phase chromatographic detection and various biochemical reaction tests.
    3. Ultra-Low Impurity Interference Multi-stage gradient chromatographic purification thoroughly removes incompletely synthesized peptide fragments, residual raw materials and inorganic salt impurities. The total impurity content is controlled at an ultra-low level, which will not interfere with cell physiological state observation, intracellular antimicrobial signal pathway research and protein binding experiment results, greatly reducing the probability of experimental errors.
    4. Flexible Customized Packaging Specifications We provide flexible customized filling specifications for academic trial experiments. Large-volume bulk drum packaging can also be customized according to customers’ long-term mass experimental research requirements. Each vial is tightly sealed with butyl rubber stopper and aluminum flip cap to guarantee excellent air tightness.

    Standard Storage Instructions

    1. Short-term Temporary Storage (Within 3 Months) Tighten the cap for full airtight sealing, store in a cool dry place away from direct sunlight, and preserve in a 2°C ~ 8°C refrigerator. Avoid frequent opening of the cap to prevent moisture absorption and air-induced molecular chain degradation.
    2. Long-term Storage (More Than 3 Months) Perform secondary sealing treatment on the bottle mouth, and store the whole product at a constant low temperature of -20°C. Repeated freezing and thawing cycles are strictly forbidden; otherwise, the spatial conformation of the polypeptide will be destroyed, resulting in decreased biological activity and poor applicability for subsequent experiments.
    3. Storage Rules After Dissolving Into Aqueous Solution The prepared aqueous experimental solution must be fully used up within 7 days under 2°C ~ 8°C refrigeration. Residual waste liquid shall be disposed of in accordance with laboratory biochemical waste management standards to avoid microbial reproduction and solution deterioration.

    Approved Application Scope

    This polypeptide raw material is only applicable to basic life science research projects conducted in university laboratories, biomedical R&D institutions and biochemical research enterprises, including but not limited to:

    1. Spatial conformation analysis and structural simulation research of antimicrobial LL37 polypeptide molecules;
    2. Cell antibacterial regulatory mechanism exploration and basic cell-related experimental research;
    3. Intracellular immune cell enzyme activity detection and metabolic pathway research;
    4. Antimicrobial signal transduction mechanism exploration experiments;
    5. Development and comparative verification of biochemical reagent formulas.

    Any commercial behaviors such as medical diagnosis, clinical treatment and human body care are forbidden.

    Global Logistics & After-Sales Support System

    We support small sample trial orders and large-volume bulk wholesale orders. After payment confirmation, our warehouse team will complete vacuum packaging and arrange delivery within 1 to 2 working days. We have long-term cooperative cross-border express carriers including EMS and UPS, covering most countries and regions in Europe, Southeast Asia, North America, Oceania and other global areas. The whole transportation cycle is about 12 to 15 working days, and the full logistics track can be checked in real time.

    Our professional foreign trade team provides one-stop supporting services for all buyers: pre-sales product parameter consultation, personalized quotation drafting, customs document sorting, post-delivery storage technical guidance, product quality inspection feedback and after-sales problem resolution. We adhere to the service tenet of stable product quality, reasonable price and sincere communication, and welcome academic researchers and biochemical raw material distributors worldwide to establish long-term stable win-win cooperation with us.


    Shop Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research-Detailed Image 1
    Shop Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research-Detailed Image 2
    Shop Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research-Detailed Image 3
    Shop Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research-Detailed Image 4
    Shop Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research-Detailed Image 5
    Shop Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research-Detailed Image 6
    Shop Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research-Detailed Image 7
    Shop Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research-Detailed Image 8
    Shop Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research-Detailed Image 9
    Shop Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research-Detailed Image 10
    Shop Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research-Detailed Image 11
    Shop Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research-Detailed Image 12
    Shop Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research-Detailed Image 13
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,Semaglutide,GHK-CU

    Location:

    Plot 1, No. 205 Tongbao Road, Jiangdong Subdistrict, Yiwu City, Jinhua City, Zhejiang Province

    Payment Terms:

    TT against B/L draft before shipment,100% TT in advance

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.