Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > FOXO4-DRI for Sale > FOXO4 High Quality FOXO4 Peptide in Stock Product 99% Powder Peptide FOXO4-DRI CAS 2460055-10-9 Lyophilized Powder
FOXO4 High Quality FOXO4 Peptide in Stock Product 99%  Powder Peptide FOXO4-DRI CAS 2460055-10-9 Lyophilized Powder buy - large image1
FOXO4 High Quality FOXO4 Peptide in Stock Product 99%  Powder Peptide FOXO4-DRI CAS 2460055-10-9 Lyophilized Powder buy - image1
FOXO4 High Quality FOXO4 Peptide in Stock Product 99%  Powder Peptide FOXO4-DRI CAS 2460055-10-9 Lyophilized Powder buy - image2
FOXO4 High Quality FOXO4 Peptide in Stock Product 99%  Powder Peptide FOXO4-DRI CAS 2460055-10-9 Lyophilized Powder buy - image3
FOXO4 High Quality FOXO4 Peptide in Stock Product 99%  Powder Peptide FOXO4-DRI CAS 2460055-10-9 Lyophilized Powder buy - image4
FOXO4 High Quality FOXO4 Peptide in Stock Product 99%  Powder Peptide FOXO4-DRI CAS 2460055-10-9 Lyophilized Powder buy - image5
FOXO4 High Quality FOXO4 Peptide in Stock Product 99%  Powder Peptide FOXO4-DRI CAS 2460055-10-9 Lyophilized Powder buy - image6

FOXO4 High Quality FOXO4 Peptide in Stock Product 99% Powder Peptide FOXO4-DRI CAS 2460055-10-9 Lyophilized Powder

TDS 28 Inquiries

Unit Price: Get Latest Price
CAS No.:

2460055-10-9

Grade:

Pharmaceutical Grade

Content:

99%

Port:

guangzhou

Brand:

ZWXS

Packaging:

5mg/vial 10vials/box

Price valid (until):

2026-08-23

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  






    we sale full list with peptide products , any other requirements just contact me!

    Name:sophia           

    email:   zwxs4@zwxstech.com

    WhatsApp: 13791008332 

              

    Product Description

    FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

    Function & Application

    FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

    Appearance: Powder

    Purity: >98% (or refer to the Certificate of Analysis)

    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Solubility: To be determined

    Shelf Life: >2 years if stored properly

    Drug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    HS Tariff Code: 2934.99.9001

    Product Specification 

    Items Specifications
    Product Name Tirzepatide
    Other Name LY3298176
    CAS 2023788-19-2
    Molecular Formula C225H348N48O68
    Appearance White power
    Molar Mass
    4813.45

    Shop FOXO4 High Quality FOXO4 Peptide in Stock Product 99%  Powder Peptide FOXO4-DRI CAS 2460055-10-9 Lyophilized Powder-Detailed Image 1 Shop FOXO4 High Quality FOXO4 Peptide in Stock Product 99%  Powder Peptide FOXO4-DRI CAS 2460055-10-9 Lyophilized Powder-Detailed Image 2


    Shop Best Price Vials 30mg Tirzepatide CAS 2023788-19-2 Peptides Weight Loss-Detailed Image 3 Shop Best Price Vials 30mg Tirzepatide CAS 2023788-19-2 Peptides Weight Loss-Detailed Image 4 Shop Best Price Vials 30mg Tirzepatide CAS 2023788-19-2 Peptides Weight Loss-Detailed Image 5


    Shop SS-31 Direct From Factory Safe Delivery Beauty Peptide Ss-31 CAS 736992-21-5-Detailed Image 6 Shop SS-31 Direct From Factory Safe Delivery Beauty Peptide Ss-31 CAS 736992-21-5-Detailed Image 7 Shop SS-31 Direct From Factory Safe Delivery Beauty Peptide Ss-31 CAS 736992-21-5-Detailed Image 8



      FAQ  





    1. How to make an order?
    Send me message and let me know what you need with quantity , then i will calculate to you

    2. What's the lead time and shipping ways?
    We will delivery to the package by USPS, FEDEX, DHL paket and YANWEN express to you after receive your payment, it would take around 5-15 days to your address.

    3. How do i keep the peptides when i receive it ?
    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    4. What's the payment methods ?
    We could accept pay through paypal,bank transfer, XTransfer and  bitcoin.



      Product features  


    (1) Triple agonist: Retalglutide is a receptor for glucagon-like peptide-1 (GLP-1), glucose-dependent insulinotropic peptide receptor (GIP) and glucagon receptor (GCG). A triple agonist, this unique multi-target mechanism of action enables it to demonstrate significant effects in weight loss and diabetes treatment.

    (2) Significant weight loss effect: In clinical trials, retarglutide has shown excellent weight loss effect. Some research results show that the weight loss of subjects can reach up to 24.2%, which is almost equivalent to the effect of bariatric surgery.

    (3) Improve blood sugar control: In addition to weight loss, retarglutide can also effectively control blood sugar levels and reduce glycated hemoglobin, making it suitable for the treatment of patients with type 2 diabetes.


      Why choose us  


     ​1. Higher quality products (>=99% purity) for most of peptides and raws. Quality Guaranteed: Many HPLC test reports are available (Janoshik).

    2. Domestic warehouses and stocks: USA, Canada, Europe and Australia.

    3. Ship worldwide with safe and secure lines: 100% delivery guaranteed. No worry about Customs issues.

    4. Special Service: Drop-shipping if need.

    5. Cheapest prices in the market, unbeatable!

    6. Many payment options: Credit card, bank transfer, wise, alipay, paysend, apple pay, google pay, wechat, bitcoin.

    Shop SS-31 Direct From Factory Safe Delivery Beauty Peptide Ss-31 CAS 736992-21-5-Detailed Image 9 Shop SS-31 Direct From Factory Safe Delivery Beauty Peptide Ss-31 CAS 736992-21-5-Detailed Image 10

    Shop SS-31 Direct From Factory Safe Delivery Beauty Peptide Ss-31 CAS 736992-21-5-Detailed Image 11


      Our Company  


    Jinan Zhiwen Technology Co., Ltd.The company spirit of "customer first, integrity first principle, with a number of enterprises to establish long-term cooperative relations. Adhere to the quality of survival, creation and development, honest, trustworthy business philosophy, adhere to the "everything quality, customer satisfaction, new, people-oriented quality policy, and constantly improve and perfect themselves. To scientific management, advanced equipment, continuous innovation, to meet the needs of customers. Good reputation and high quality products, has been the majority of domestic and foreign merchants consistent trust. Won the trust of our customers and won the praise of customers!

    Shop SS-31 Direct From Factory Safe Delivery Beauty Peptide Ss-31 CAS 736992-21-5-Detailed Image 12 Shop SS-31 Direct From Factory Safe Delivery Beauty Peptide Ss-31 CAS 736992-21-5-Detailed Image 13


    Packaging


    Shop SS-31 Direct From Factory Safe Delivery Beauty Peptide Ss-31 CAS 736992-21-5-Detailed Image 14 Shop SS-31 Direct From Factory Safe Delivery Beauty Peptide Ss-31 CAS 736992-21-5-Detailed Image 15


      Advantage&shipping


    Shop SS-31 Direct From Factory Safe Delivery Beauty Peptide Ss-31 CAS 736992-21-5-Detailed Image 16 Shop SS-31 Direct From Factory Safe Delivery Beauty Peptide Ss-31 CAS 736992-21-5-Detailed Image 17

    ECHEMI Editorial Reference
    FOXO4-DRI (Retro-Inverso) is a synthetic, slightly modified version of the standard FOXO4 protein. The modification prolongs half-life of the protein and allows it to interfere with normal FOXO4 function. FOXO4-DRI has been shown in research to prevent normal FOXO4 binding to p53, thereby allowing for elimination of senescent cells, improved organ function, and younger tissue “biological age.” FOXO4-DRI impacts insulin signaling, cell cycle regulation, and oxidative stress signaling pathways. FOXO4-DRI is a cell penetrating peptide shown to selectively induce apoptosis of senescent cells thereby reversing effects of aging in animal studies.
    Research & Reference Note

    FOXO4 High Quality FOXO4 Peptide in Stock Product 99% Powder Peptide FOXO4-DRI CAS 2460055-10-9 Lyophilized Powder is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • FOXO4 High Quality FOXO4 Peptide in Stock Product 99%  Powder Peptide FOXO4-DRI CAS 2460055-10-9 Lyophilized Powder Certificates 1 TDS

    Basic Info
    Product Name:

    FOXO4-DRI

    Other Name:

    FOXO4-DRI;FOXO4 /FOXO4-DRI;FOX04-DRI (D-Retro-Inverso);Fox4-dri

    CAS No.:

    2460055-10-9

    Molecular Weight:

    0

    Color/Form:

    White to off-white

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    No. 41-9, Fenghuangshan Road, Beiyuan Street, Tianqiao District, Jinan City, Shandong Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    3

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    Jinan Zhiwen Technology Co., Ltd. is a professional manufacturer and supplier of pharmaceutical raw materials, peptide compounds and fine chemicals. We own standardized laboratories and complete quality inspection procedures, strictly testing every batch for purity and consistency. Our product portfolio covers hot‑sale peptide APIs, chemical intermediates for biomedical research. Serving clients worldwide, we provide custom synthesis, sample support, flexible order volumes and end‑to‑end supply‑chain solutions. Committed to quality‑first principle, we strive to become your long‑term and dependable partner for biochemical raw‑material procurement.


    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    Peak season lead time: within 3 Workday; Off season lead time: within 1 Workday

  • Inquiry History
    28 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    FOXO4-DRI

    1 G Dec 3, 2023
    Germany

    foxo4-dri

    1 G Aug 23, 2026
    United States

    Fox04-dri

    1 G May 20, 2026
    United States

    hot-sale-high-purity-raw-powder-fox04-dri-nad-ghk-cu-mot

    2 PCS Dec 19, 2025
    United States

    foxo4 dri

    10 MT Dec 13, 2025
    United States

    Fox04

    10 MG Oct 30, 2024
    Norway

    FOXO4-DRI

    200 MG Sep 3, 2026
    United Kingdom

    High purity foxo4

    1 G May 31, 2026
    United Kingdom

    Foxo4-Dri

    10 MG May 5, 2026
    United States

    Fox04-dri

    100 MG Apr 28, 2026
    Cyprus

    Foxo4 dri

    10 MT Apr 4, 2026
    Cyprus

    FOXO4-DRI

    1 KG Feb 2, 2026
    United States

    FOX04-DRI

    10 PCS Jan 12, 2026
    United States

    FOX04

    10 PCS Jan 12, 2026
    United States

    Foxo4 Dri

    40 MG Sep 15, 2025
    United States

    Fox04 dri

    10 MT Jun 21, 2026
    United States

    FOX04-DRI powder

    10 MT May 29, 2026
    United States

    fox04

    1 G Apr 29, 2026
    United States

    FOXO4-DRI

    1 KG Mar 23, 2026
    United States

    Foxo4-Dri

    Nov 24, 2025
    • 1
    • 2
    • Go to Page Go
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.