FOXO4 High Quality FOXO4 Peptide in Stock Product 99% Powder Peptide FOXO4-DRI CAS 2460055-10-9 Lyophilized Powder

we sale full list with peptide products , any other requirements just contact me!

Name:sophia           

email:   zwxs4@zwxstech.com

WhatsApp: 13791008332 

Product Description

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

Function & Application

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

Appearance: Powder

Purity: >98% (or refer to the Certificate of Analysis)

Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

Solubility: To be determined

Shelf Life: >2 years if stored properly

Drug Formulation: To be determined

Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

HS Tariff Code: 2934.99.9001

1. How to make an order?
Send me message and let me know what you need with quantity , then i will calculate to you

2. What's the lead time and shipping ways?
We will delivery to the package by USPS, FEDEX, DHL paket and YANWEN express to you after receive your payment, it would take around 5-15 days to your address.

3. How do i keep the peptides when i receive it ?
Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

4. What's the payment methods ?
We could accept pay through paypal,bank transfer, XTransfer and  bitcoin.

(1) Triple agonist: Retalglutide is a receptor for glucagon-like peptide-1 (GLP-1), glucose-dependent insulinotropic peptide receptor (GIP) and glucagon receptor (GCG). A triple agonist, this unique multi-target mechanism of action enables it to demonstrate significant effects in weight loss and diabetes treatment.

(2) Significant weight loss effect: In clinical trials, retarglutide has shown excellent weight loss effect. Some research results show that the weight loss of subjects can reach up to 24.2%, which is almost equivalent to the effect of bariatric surgery.

(3) Improve blood sugar control: In addition to weight loss, retarglutide can also effectively control blood sugar levels and reduce glycated hemoglobin, making it suitable for the treatment of patients with type 2 diabetes.

 ​1. Higher quality products (>=99% purity) for most of peptides and raws. Quality Guaranteed: Many HPLC test reports are available (Janoshik).

2. Domestic warehouses and stocks: USA, Canada, Europe and Australia.

3. Ship worldwide with safe and secure lines: 100% delivery guaranteed. No worry about Customs issues.

4. Special Service: Drop-shipping if need.

5. Cheapest prices in the market, unbeatable！

6. Many payment options: Credit card, bank transfer, wise, alipay, paysend, apple pay, google pay, wechat, bitcoin.

Jinan Zhiwen Technology Co., Ltd.The company spirit of "customer first, integrity first principle, with a number of enterprises to establish long-term cooperative relations. Adhere to the quality of survival, creation and development, honest, trustworthy business philosophy, adhere to the "everything quality, customer satisfaction, new, people-oriented quality policy, and constantly improve and perfect themselves. To scientific management, advanced equipment, continuous innovation, to meet the needs of customers. Good reputation and high quality products, has been the majority of domestic and foreign merchants consistent trust. Won the trust of our customers and won the praise of customers!