Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide
Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide buy - large image1
Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide buy - image1
Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide buy - image2
Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide buy - image3
Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide buy - image4
Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide buy - image5
Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide buy - image6

Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide

2 Inquiries

Unit Price:

$10-13/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

tianjin

Brand:

Henghua

Packaging:

10vials/box

Price valid (until):

2026-09-04

Company Type:
Trader
Location:
China
Qualification:
Main Products:

S3,14 bd0

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 1


    Products Name: LL-37
    Chemical Name: LL-37 Antibacterial Protein
    CAS No: 597562-32-8
    Molecular Formula: C205H341N61O52
    Molecular Weight: 4492.28g/mol
    Purity: >98.0%
    Application: Antibacterial peptide
    Appearance: White Lyophilized powder
    Reconstitution: Required
    Storage: After reconstitution store at 2°C - 8°C

    LL-37 is the only known human Cathelicidin is a big protein family where the members exhibit diverse functions. These peptides, essentially produced by macrophages and polymorphonuclear leukocytes (both types of white blood cells), have bactericidal action. They have been found to have shown other substantial effects as well. The entire group is often referred to as antimicrobial peptides (AMPs). LL-37 in particular has been found to play significant roles in autoimmune disease, cancer, and wound healing


    Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 2
    Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 3



      Packaging & Shipping  


    Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 4
    Europe 1-3days
    America 1-3days
    UK/Russia/Malaysia 1-3days
    North America 1-3days
    Air freight 1-3days
    Sea transport 1-3days
    Land transport 1-3days
    Packaging: vacuum packaging/aluminum foil packaging/fake packaging/sealed packaging
    Transportation: Sea/Air/land transportation. 
    Customs: 100% safe delivery, free re-delivery of any customs problems, guaranteed delivery


      Our Advantages


     Goods quality

    1. Product has COA, and HPLC report
    2. Our factory is ISO9001 standard
    3. We get good feedback from customers around the world

    OEM service
    1. Add customer's logo
    2. Redesign label, packing box as customer's requirement
    3. Cap color can be customized

    Shipping service
    1. Goods shipped in 2-7 days after get payment.
    2. Small order ship by express door to door.
    3. Goods arrive in 7-20 days

    24 hours on-time response
    1. Reply your inquiry within 12 hours
    2. Keep tracking goods and update information to custom er
    3. After-sale service anytime
    Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 5


    Feedback from customers


    Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 6


      Company Profile  


    NINGBO HENGHUA TECHNOLOGY DEVELOPMENT CO., LTD. Is A PROFESSIONAL ENTERPRISE ENGAGED IN EXPORT, the products mainly include chemical products, medical devices, masks, machinery, chemical RAW materials, pharmaceutical INTERMEDIates.

    We have more and more customers from all over the world. We can provide our customers with the best product quality and reasonable price. Our aim is "service and sincere exchange for your trust and support, mutual benefit and win-win". We look forward to working with friends all over the world!

    In order to meet the requirements of importers and middlemen, further provide customers with "door to door" service.

    We have our own export service system, can provide customers with the best export route and the lowest price.
    We have a skilled, operational ability of the team.

    In addition, we can find the goods with the lowest price and the best quality for overseas customers,

    check the goods and reserve shipping space, so as to open up the Chinese market and relieve the import and export. 

    Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 7

    Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 8


      FAQ  


    Q1: About the after-sale service of products
    A: After purchasing the products from our factory, we have A professional technical team and after-sales team to serve you and solve all your problems in the future

    Q2: Can I get some samples?
    A: Yes, we can provide samples, but the customer will pay the freight.

    Q3: How do I start paying?
    Payment can be made by Bitcoin,TT, L/C, DP  

    Q4: How to confirm product quality before placing an order?
    A: You can get free samples of some products. You just have to pay the shipping fee

    Q5: What is your MOQ?
    A: The minimum quantity we can order is 1kit.

    Q6: How to customize the product??
    A:You can send us your product specifications and requirements and we will produce products according to your requirements.

    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    S3,14 bd0

    Location:

    Room8-18,building156,No.19,26,27,QinglinCommercial Plaza,Haishu District,Ningbo City,Zhejiang Province

    Payment Terms:

    TT against copy of documents,L/C,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    11-50

    Year of Establishment:

    2020

    Ningbo Henghua Technology Development Co., Ltd. is a company specialized in export. Our main products include pharmaceutical intermediates, food additives, chemical products, and cosmetic raw materials. These products are exported to over 80 countries and regions, including North America, Europe, Singapore, Australia, Russia, Africa, the Middle East, and more. Additionally, we offer product customization services to meet the specific needs of our clients. With a global customer base, we are able to provide the best product quality at competitive prices.

    To further meet customer demands and offer "door-to-door" services, we have established our own export service system. This allows us to provide clients with optimal export routes at the lowest possible prices.

    Moreover, we have a top-tier R&D team, a professional production team, and a strict quality control department, enabling us to offer overseas clients the best goods at the lowest prices, inspect products, and reserve shipping spaces, thus facilitating the expansion of the Chinese market and eliminating concerns regarding import and export. We also provide patient and attentive after-sales service to assist with any issues during the order process.

    By choosing henghua, you will have a reliable partner, high-quality products, fast and secure transportation, and worry-free after-sales support. Our mission is to "earn your trust and support through service and sincerity, achieving mutual benefit and win-win outcomes." We adhere to the management principles of "Quality First, Service First, Continuous Improvement, and Innovation to Satisfy Customers," with a quality goal of "Zero Defects, Zero Complaints." Henghua Technology looks forward to cooperating with friends from all over the world!

  • Inquiry History
    2 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.