Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg buy - large image1
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg buy - image1
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg buy - image2
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg buy - image3
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg buy - image4
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg buy - image5
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg buy - image6

Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg

TDS 1 Inquiries

Unit Price:

$50/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

guangzhou

Brand:

CaoQuan

Packaging:

5mg/vial 10vials/box

Price valid (until):

2029-11-22

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Cagrilintide,Tirzepatide,Semaglutide,Retatrutide,NAD+,Melatonine

  • Product Description

  • Seller Information

  • History Price

  • Inquiry History

  • Description

    Sales: Alan
    Mail: 17832695638 @ 163 .com
    Whatsapp: +86 1 7832695638

    we sale full list with peptide products , any other requirements just contact me !!!

     

    Model NO.

    /

    Specification

    5mg

    Purity

    99%

    Production Capacity

    10000PCS/Day

    Color

    White

    Certification

    GMP, ISO KOSHER

    Origin

    China

    Transport Package

    10vials/Box

    Trademark

    Caoquan

    Transport Package

    Box


      Product Detail  


    Shop Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg-Detailed Image 1
    Shop Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg-Detailed Image 2
    Shop Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg-Detailed Image 3
    Shop Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg-Detailed Image 4
    Shop Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg-Detailed Image 5
    Shop Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg-Detailed Image 6
      1. LL-37 is the only known human Cathelicidin is a big protein family where the members exhibit diverse functions. These peptides, essentially produced by macrophages and polymorphonuclear leukocytes (both types of white blood cells), have bactericidal action. They have been found to have shown other substantial effects as well. The entire group is often referred to as antimicrobial peptides (AMPs). LL-37 in particular has been found to play significant roles in autoimmune disease, cancer, and wound healing

        Product Name LL37 CAS 597562-32-8 Cosmetic Raw Material Powder Janoshik 3rd Labtedting Injection Peptide with Best Price Hot Sale
        Product Name LL37
        CAS 597562-32-8
        MF C205H341N61O52
        EINECS NO 200-001-8
        Purity 99.8%
        Delivery 8-10Days
        Production Capacity 10 Tons/Month
        Payment method
        PAYPAL,ALIBABA,BANK 
        Transport Package TNT, DHL, FedEx, UPS, EMS
        Shelf Life 2 Years


      Packing and Shipping


    Packing

    Changsha CaoQuan Biotechnology Co., Ltd.  takes great care in packaging. We use sturdy materials to protect goods from damage during transit, with tailored packaging for different products. Every item is securely sealed and labeled clearly. Our strict packaging standards ensure items arrive in perfect condition. With a track record of reliable deliveries, we’ve gained clients’ trust. You can count on us for safe, professional packaging.

    Shop Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg-Detailed Image 7
    Shop Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg-Detailed Image 8
    Shop Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg-Detailed Image 9
    Shipping

    Changsha CaoQuan  Biotechnology Co., Ltd. Company offers diverse shipping options: air, land, and sea transport. Orders are shipped within one day of placement, with delivery expected within a week. Boasting a high volume of successful transactions, we’ve earned strong trust from clients. Our efficient logistics ensure timely, reliable delivery, making us a dependable partner for your shipping needs.

    Shop Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg-Detailed Image 10
    Shop Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg-Detailed Image 11


     Company introduction 


    Changsha Caoquan Technology Co., Ltd. is a high-tech company specializing in the research and development and production of polypeptide drugs. The company has an advanced industrial chain, covering the research and development, approval and industrialization of peptide raw materials and preparations. Its products include innovative drugs, raw materials, enzymes used in medicine and green synthesis industry, functional peptides and protein products.

    Our core strengths are advanced polypeptide technology, strict quality control (conforming to cGMP standards), professional R&D team, and end-to-end solutions from raw materials to finished products.

    We are committed to providing customers with high-quality and high-value products and services and have established a good reputation in the global market. With excellent product quality, logistics service and customer-centered business philosophy, our products have been exported to more than 100 countries.

    Changsha Cao Quan is willing to maintain cooperative relations with old and new friends and create a better future together!

    Shop Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg-Detailed Image 12
    Shop Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg-Detailed Image 13
    Shop Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg-Detailed Image 14
    Shop Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg-Detailed Image 15

    Note:

    1.High quality and competitive price.

    2.Promptly delivery by well-reputed shipping lines.

    3.Trial order is available for testing after samples.

    4.We will inform you all the information at every stage in advance.

    5.Packaging can gear to buyers’ special request.




     FAQ


    Q1: About the after-sale service

    A: After purchasing the products from our Lab, we have A professional technical team and after-sales team to serve you and solve all your problems in the future

     

    Q2: Can I get some samples?

    A: Yes, we can provide samples, but the customer will pay the freight.

     

    Q3: How do I start paying?

    Payment can be made by Bitcoin,wire transfer or paypal

     

    Q4: How to confirm product quality before placing an order?

    A: We got good feedback from customers and Tested by third-party institutions. You also can get free samples of some products. You just have to pay the shipping fee for the sample .

    You can send us your product specifications and requirements and we can customize for you.

     

    Q5: What is your MOQ?

    A: The minimum quantity we can order is 1 box.

    But usually we can accept a smaller quantity, say 100g, at the cost of 100% sample charge.

     

    Q6: Time for delivery?

    A: Leading time within 3 business days,Shipping time about 8-10 business days.

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Cagrilintide,Tirzepatide,Semaglutide,Retatrutide,NAD+,Melatonine

    Location:

    Room 102, No. 60-20, Gongnong Street, Xiangya Road Subdistrict, Kaifu District, Changsha City, Hunan Province, China

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    1

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2023

  • Weekly Price

    The chart shows the price trend of the product in the past 12 months.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.