Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Teriparatide | China Factory | Cosmetic Peptides | 99% Purity | Lyophilized Powder | hign quality Betty
Teriparatide | China Factory | Cosmetic Peptides | 99% Purity  | Lyophilized Powder | hign quality Betty buy - large image1
Teriparatide | China Factory | Cosmetic Peptides | 99% Purity  | Lyophilized Powder | hign quality Betty buy - image1
Teriparatide | China Factory | Cosmetic Peptides | 99% Purity  | Lyophilized Powder | hign quality Betty buy - image2
Teriparatide | China Factory | Cosmetic Peptides | 99% Purity  | Lyophilized Powder | hign quality Betty buy - image3
Teriparatide | China Factory | Cosmetic Peptides | 99% Purity  | Lyophilized Powder | hign quality Betty buy - image4
Teriparatide | China Factory | Cosmetic Peptides | 99% Purity  | Lyophilized Powder | hign quality Betty buy - image5
Teriparatide | China Factory | Cosmetic Peptides | 99% Purity  | Lyophilized Powder | hign quality Betty buy - image6

Teriparatide | China Factory | Cosmetic Peptides | 99% Purity | Lyophilized Powder | hign quality Betty

10 Inquiries

Unit Price:

$5/UNIT FOB

Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical

Content:

99%

Port:

HongKong

Packaging:

10vial

Price valid (until):

2026-11-03

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,NAD+,Samaglutide,GHK-CU,cagrilintide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Contact us

    Contact us: Whatsapp:+852 9184 0124

    Product Detail   



    Here is an English product overvied for Teriparatid   :

    Composition:
    Teriparatide is a recombinant, synthetically produced 34‑amino‑acid polypeptide corresponding to the biologically active N‑terminal fragment of human parathyroid hormone (hPTH 1‑34), with the sequence Ser‑Val‑Ser‑Glu‑Ile‑Gln‑Leu‑Met‑His‑Asn‑Leu‑Gly‑Lys‑His‑Leu‑Asn‑Ser‑Met‑Glu‑Arg‑Val‑Glu‑Trp‑Leu‑Arg‑Lys‑Lys‑Leu‑Gln‑Asp‑Val‑His‑Asn‑Phe (C₁₈₁H₂₉₁N₅₅O₅₁S₂, MW ≈ 4117.7 Da), expressed via recombinant DNA technology in Escherichia coli and supplied as a highly purified lyophilized powder for laboratory research.

    Mechanism of Action:
    It functions as a selective agonist at the parathyroid hormone type 1 receptor (PTH1R), a class‑B G protein–coupled receptor abundantly expressed on osteoblasts, osteocytes, and renal cells. Binding activates Gs‑cAMP‑PKA and Gq‑PLC‑PKC signaling cascades as well as β‑arrestin–mediated pathways; intermittent exposure preferentially stimulates osteoblast differentiation from mesenchymal stem cells, prolongs osteoblast survival by suppressing apoptosis, activates quiescent bone‑lining cells, and upregulates Wnt/β‑catenin signaling via sclerostin inhibition—thereby promoting net bone formation while briefly increasing renal calcium reabsorption and phosphate excretion.

    Research Advantages:
    Unlike antiresorptive agents, Teriparatide exhibits a well‑characterized anabolic window in which pulsatile receptor activation yields dose‑dependent increases in trabecular and cortical bone volume, callus formation in fracture models, and upregulation of bone‑formation biomarkers (e.g., osteocalcin, bone‑specific alkaline phosphatase) without immediate parallel rise in resorption markers. Its defined peptide structure, reproducible pharmacokinetics in animal models, and the clear differential between intermittent (anabolic) versus continuous (catabolic) PTH signaling make it a valuable reference compound for studying osteoblast biology, bone‑remodeling coupling, and skeletal regenerative pharmacology.

    Intended Research Population:
    This compound is intended for non‑clinical, in vitro, and in vivo investigations involving osteoporosis models (post‑menopausal, androgen‑deficient, or glucocorticoid‑induced), age‑related bone loss, fracture‑healing and distraction‑osteogenesis models, scaffold‑based bone‑tissue‑engineering studies evaluating osteoinductive adjuvants, and basic research on PTH1R signal transduction and Wnt pathway crosstalk; it is an investigational reagent restricted to scientific laboratory use and is not approved for therapeutic, diagnostic, or human administration outside controlled experimental protocols.



    Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 1



    Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 2 Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 3 Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 4 Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 5 Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 6




    Basic Info



       Items Specifications
    Product  Name
    Teriparatide
    CAS number 52232-67-4
    Purity 99%
    Appearance White or almost white powder
    Storage Dry and Cool Place

    Grade Standard

    Top Quality

    Grade Pharmaceutical Grade
    Specification 5mg 10mg 20mg


      Our Company  


    Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.

    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements


    Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 7

    Shop GHK-CU High quality high purity GHK-CU CAS 89030-95-5 Copper tripeptide for Long-Lasting Skin  Hot-selling-Detailed Image 2 Shop GHK-CU High quality high purity GHK-CU CAS 89030-95-5 Copper tripeptide for Long-Lasting Skin  Hot-selling-Detailed Image 3 Shop GHK-CU High quality high purity GHK-CU CAS 89030-95-5 Copper tripeptide for Long-Lasting Skin  Hot-selling-Detailed Image 4 Shop GHK-CU High quality high purity GHK-CU CAS 89030-95-5 Copper tripeptide for Long-Lasting Skin  Hot-selling-Detailed Image 5 Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 12


      Why choose us  


    Our Advantages:

    1.High quality with competitive price.

    2. All purity>99%.

    3. We are manufacturer and can provide high quality products with factory price.

    Fast and safe delivery.

    1. Parcel can be sent out in 24 hours after payment tracking number available.

    2. Secure and discreet shipment verious transportation methods for your choice.

    3. Customs pass rate >99%.

    We have clients throughout the world.

    1. Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.

    2. Market feedback and goods feedback will be appreciated, meeting customers’ requirement is our principal responsibility.

    3. High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.

    Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 13

    Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 14


      FAQ   


    1. How to make an order?
    Send me message and let me know what you need with quantity , then i will calculate to you

    2. What's the lead time and shipping ways?
    We will delivery to the package by UPS, FEDEX, DHL paket and YANWEN express to you after receive your payment, it would take around 5-15 days to your address.

    3. How do i keep the peptides when i receive it ?
    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    4. What's the payment methods?
    We could accept pay through Wise, Bank Transfer, Alipay,Alibaba USDT and BTC.


    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.
    Research & Reference Note

    Teriparatide | China Factory | Cosmetic Peptides | 99% Purity | Lyophilized Powder | hign quality Betty is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,NAD+,Samaglutide,GHK-CU,cagrilintide

    Location:

    1502A1, Building 4, Xinyuanxin Center, No. 3 Huaxin Road, Dongfeng Street, Licheng District, Jinan City, Shandong Province

    Payment Terms:

    TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    1

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    51-100

    Year of Establishment:

    2026

    Certifications:

    COA,COA,COA,COA,COA,COA,COA,COA,COA,COA,COA,COA

    COMPANY INTRODUCTION

    20 years of dedicated work in the peptide industry

    15 Years of Industry Experience

    We have been a high-tech company focused on the development, production, and marketing of various peptide products

     for 15 years. Through advanced laboratories and strict quality control, our internationally certified products are safe and 

    effective.


    Clients in Europe, the USA, Southeast Asia, and the Middle East

    As a global trading company, we serve clients across Europe, the USA, Southeast Asia, the Middle East, and beyond, providing

     customized solutions. Committed to "technology leading Health", we aim to innovate and deliver high-quality health products 

    worldwide.


    3,000sqm Factory with 60 Employees

    We have a factory covering 3,000 square meters and housing 60 employees to guarantee the highest quality all the time. We hired 

    three quality auditors with three years of experience. They meticulously inspect each item at every production stage.


    Contact Us Now

    Our products are exported to more than 130 countries and regions, which can be delivered fast within 5-14 days. We can provide

     OEM/ODM support to our customers. We have 10 professional after-sales staff to make 24-hour responses to our customers. 

    Contact us now to learn more. We hope to establish stable and strategic long-term business relationships with domestic and 

    foreign suppliers and customers, jointly pursuing a better future.


  • Inquiry History
    10 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.