Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 | Cosmetic Peptides | 99% Purity | 5mg -10mg Vials 356210
LL37 |  Cosmetic Peptides | 99% Purity | 5mg -10mg Vials 356210 buy - large image1
LL37 |  Cosmetic Peptides | 99% Purity | 5mg -10mg Vials 356210 buy - image1
LL37 |  Cosmetic Peptides | 99% Purity | 5mg -10mg Vials 356210 buy - image2
LL37 |  Cosmetic Peptides | 99% Purity | 5mg -10mg Vials 356210 buy - image3
LL37 |  Cosmetic Peptides | 99% Purity | 5mg -10mg Vials 356210 buy - image4
LL37 |  Cosmetic Peptides | 99% Purity | 5mg -10mg Vials 356210 buy - image5
LL37 |  Cosmetic Peptides | 99% Purity | 5mg -10mg Vials 356210 buy - image6

LL37 | Cosmetic Peptides | 99% Purity | 5mg -10mg Vials 356210

3 Inquiries

Unit Price:

$7/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Tianjin

Packaging:

box-packed

Price valid (until):

2028-05-12

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Description


    Sales manager:Lily
    whatsapp: +85244600701
    Email:lily@facaipeptides.com

    Items Specifications
    Product  Name LL37
    CAS number 154947-66-7
    Purity 99%
    Appearance White or almost white powder
    Specification 10mg


      Product Detail  


    LL-37 is a popular bioactive peptide material with stable molecular structure, marked with molecular formula C₂₀₅H₃₄₀N₆₀O₅₃ on our vial label. Our standard specification is 5mg per vial, with a guaranteed purity up to 99%. All batches are newly produced in 2026, and we maintain steady spot inventory to support bulk orders and small sample requests for global partners.
    This peptide material boasts outstanding bio-regulating properties, widely applied in skin care research and cosmetic raw material development. It can effectively balance surface microenvironment, relieve uncomfortable skin conditions caused by external stimuli, and assist in maintaining smooth, stable skin texture. Many laboratory and cosmetic brands choose this raw material for formulation research, as it presents fine white lyophilized powder with excellent solubility when matched with BAC Water solvent.
    Each vial adopts transparent glass bottle with blue sealing cap, light and portable for storage and transportation. Our warehouse can complete packaging and delivery within short time after receiving your order. We support flexible order quantities, whether you need trial samples or large wholesale batches.

    Shop LL37 |  Cosmetic Peptides | 99% Purity | 5mg -10mg Vials 356210-Detailed Image 1 Shop LL37 |  Cosmetic Peptides | 99% Purity | 5mg -10mg Vials 356210-Detailed Image 2


    the common problems


    Q1: May I get one sample before placing order?

    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.

    Q2: Which payment is available for your company?

    Re: T/T, PayPal,bank transfer etc. You can choose the one which is convenient for you.

    Q3: How and when can I get my goods after payment?

    Re: For small quantity products, they will be delivered to you by international courier(DHL, FedEx, TNT etc.) or by air. Usually it will cost 5-7days that you can get the goods after delivery.For large quantity products, shipping by see is worthwhile.It will cost 15 to 30 days to come to your destination port, which depends on where the port is.

    Q4: Is there any possible to use my appointed label or package?

    Re: Yes. If needed, we'd lik

    Shop LL37 |  Cosmetic Peptides | 99% Purity | 5mg -10mg Vials 356210-Detailed Image 3 Shop LL37 |  Cosmetic Peptides | 99% Purity | 5mg -10mg Vials 356210-Detailed Image 4


       Why choose us?


    1.Higher quality products (>=99% purity) for most of peptides and raws., adequate stock and fast delivery competitive price.

    2. Ship worldwide with safe and secure lines: 

    3. Special Service: Drop-shipping if need.

    4. Cheapest prices in the market, unbeatable!

    5. Many payment options:Wise, Bank Transfer, Alipay,alibaba

    6.Safe and fast delivery
    Shop LL37 |  Cosmetic Peptides | 99% Purity | 5mg -10mg Vials 356210-Detailed Image 5 Shop LL37 |  Cosmetic Peptides | 99% Purity | 5mg -10mg Vials 356210-Detailed Image 6

    If you need any assistance, please feel free to contact us at any time!

    Sales manager:Lily
    whatsapp:+85244600701
    Email:lily@facaipeptides.com

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL37 | Cosmetic Peptides | 99% Purity | 5mg -10mg Vials 356210 is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide

    Location:

    Room 1501, Building 1, Changnan Mansion, Country Garden, on the west side of Taoyang North Road

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    11

    Year of Establishment:

    2025

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.