Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Teriparatide/99% purity/10mg TER10/ Treating osteoporosis
Teriparatide/99% purity/10mg TER10/ Treating osteoporosis buy - large image1
Teriparatide/99% purity/10mg TER10/ Treating osteoporosis buy - image1
Teriparatide/99% purity/10mg TER10/ Treating osteoporosis buy - image2
Teriparatide/99% purity/10mg TER10/ Treating osteoporosis buy - image3
Teriparatide/99% purity/10mg TER10/ Treating osteoporosis buy - image4
Teriparatide/99% purity/10mg TER10/ Treating osteoporosis buy - image5
Teriparatide/99% purity/10mg TER10/ Treating osteoporosis buy - image6

Teriparatide/99% purity/10mg TER10/ Treating osteoporosis

10 Inquiries

Unit Price:

$176/UNIT FOB

Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HongKong

Brand:

HUATAI

Packaging:

10 vials/kit

Price valid (until):

2026-09-10

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,NAD+,Samaglutide,GHK-CU,cagrilintide

  • Product Description

  • Seller Information

  • History Price

  • Inquiry History

  • Description


    How to place an order


    Add to WhatsApp: +85244962136 Amy  

    I will provide you with more comprehensive information.

    Simply send us a message with the quantity you need. I will calculate the price and offer you a special discount. Once payment is confirmed, we will prioritize your order for immediate dispatch.

    Shop Teriparatide/99% purity/10mg TER10/ Treating osteoporosis-Detailed Image 1


      Product Introduction  


    •      Teriparatide is a recombinant human parathyroid hormone (1-34) and is currently one of the very few bone-forming agents in clinical practice capable of promoting new bone formation.
      Physicochemical Properties
      • Chemical Nature: It is a synthetically produced polypeptide. Its amino acid sequence is identical to the N-terminal 34 amino acids (the biologically active region) of native human parathyroid hormone.
      • Physicochemical Parameters: Its chemical formula is C181H291N55O51S2, with a molecular weight of approximately 4117.7.
      • Formulation Characteristics: Clinically, it is typically formulated as a lyophilized powder  or a clear, colorless solution in a pre-filled syringe. It must be stored in the dark under refrigerated conditions at 2~8°C.
      Mechanism of Action
      • Target Binding: Upon entering the body, the drug binds with high affinity to parathyroid hormone receptors (PTH1 receptors) on the surface of bone and renal cells, thereby mediating downstream physiological effects.
      • Promotion of Bone Formation: Unlike traditional anti-osteoporosis drugs (which primarily function by inhibiting bone resorption), the core mechanism of teriparatide is to stimulate osteoblasts, increasing both their number and activity while preventing their apoptosis (programmed cell death).
      • Improvement of Bone Microarchitecture: By continuously stimulating new bone formation on the surfaces of trabecular and cortical bone, it significantly improves trabecular microarchitecture, increases bone mass, and enhances overall bone strength, thereby reducing the risk of vertebral and non-vertebral fractures.


    Shop Teriparatide/99% purity/10mg TER10/ Treating osteoporosis-Detailed Image 2

    Shop Teriparatide/99% purity/10mg TER10/ Treating osteoporosis-Detailed Image 3

    Items Specifications
    Product Name Teriparatide
    CAS number 52232-67-4
    Purity 99%
    Molecular Weight 4117.7g/mol
    Appearance White Lyophilized powder
    Storage Dry and Cool Place
    Grade Standard Top Quality
    Specification Pharmaceutical Grade
    Specifications  10mg

    52232-67-4

    Teriparatide

    Shop Teriparatide/99% purity/10mg TER10/ Treating osteoporosis-Detailed Image 4


     How to store  


          The core principle for storing parenteral lyophilized powder is strict refrigeration and absolutely no freezing. Before reconstitution, it is generally stored in the dark at 2 to 8°C. Once mixed and dissolved with the solvent, it must be used within a very short period.

    Before Reconstitution (Original Packaging)

    Strict Refrigeration: The vast majority of parenteral lyophilized powders need to be stored in a refrigerator at 2 to 8°C.

    Absolutely No Freezing: Freezing will cause irreversible damage to the structure of proteins and peptides.

    Protection from Light and Moisture: The product must be kept in its original packaging to avoid direct sunlight and accidental exposure to moisture.

    After Reconstitution (Mixed State)

    Highly Time-Sensitive: Once the lyophilized powder is dissolved with a sterile solvent, the stability of the drug drops significantly. It usually needs to be administered immediately or within a very short window (e.g., a few hours).

    No Prolonged Storage: Under no circumstances should the reconstituted solution be stored in the refrigerator for use the next day. This can easily lead to loss of efficacy or severe bacterial contamination.

    Shop Teriparatide/99% purity/10mg TER10/ Treating osteoporosis-Detailed Image 5

    Shop Teriparatide/99% purity/10mg TER10/ Treating osteoporosis-Detailed Image 6


      Packing process

      


    Shop Teriparatide/99% purity/10mg TER10/ Treating osteoporosis-Detailed Image 7


    About Logistics


     * We will ship your order within 24–48 hours after payment is received.

     * We have dedicated shipping routes, allowing us to select the fastest and safest carrier for your specific destination—including FedEx, UPS, China Post, and other international express services. The estimated delivery time is approximately 7–15 business days.

     * We will also track the logistics throughout the entire process and update the logistics information for buyers in real time.

    Shop Teriparatide/99% purity/10mg TER10/ Treating osteoporosis-Detailed Image 8


    Company Profile  


              Our company is located in Zhejiang Province and is a Chinese enterprise specializing in the production of peptide products.We are not intermediaries or resellers; we are the original manufacturer. This allows us to offer you the most competitive pricing. Our motto is: to manufacture products with care and serve customers with dedication.We are dedicated to serving every visitor with heart. No matter where you come from, you will experience our premium VIP service. We guarantee that every customer receives only the finest products, backed by exceptional after-sales support, as we strive to ensure your complete satisfaction.

    Shop Teriparatide/99% purity/10mg TER10/ Treating osteoporosis-Detailed Image 9

    Shop Teriparatide/99% purity/10mg TER10/ Treating osteoporosis-Detailed Image 10

    Shop Teriparatide/99% purity/10mg TER10/ Treating osteoporosis-Detailed Image 11

    Shop Teriparatide/99% purity/10mg TER10/ Treating osteoporosis-Detailed Image 12


      FAQ 


    1. What's the payment methods?
    We could accept pay through Alipay, USDT, BTC and TT.

    2.Does the product have a test report?
    Each batch of our products undergoes testing before leaving the factory, and a Certificate of Analysis (COA) report is issued.

    3.Can customers customize their own labels?

    Custom labeling services are available. Please contact us to discuss your specific requirements prior to placing an order.

    4.What is the product's shelf life?

    When unopened, our products have a shelf life of two years under both room temperature and frozen storage conditions. Therefore, you can rest assured that extended shipping times will not cause the product to expire or degrade.


      Why Choose Us  



    1.  * Ultra-High Purity Guaranteed
      Every batch is synthesized and purified to >99% purity, delivering the reliability and reproducibility your sensitive experiments demand.
    2.  * Precision Dosing & Batch Consistency
      Peptides are accurately weighed and vacuum-sealed under sterile conditions. We enforce rigorous quality control to ensure unwavering consistency from batch to batch.
    3.  * Endotoxin-Free & Sterile Assurance
      Produced in a certified cleanroom, our peptides are rigorously tested to be free of endotoxins, microbes, and impurities—safeguarding the integrity of your cell-based and in vivo studies.

    Shop Teriparatide/99% purity/10mg TER10/ Treating osteoporosis-Detailed Image 13

    ECHEMI Editorial Reference
    The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
    Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,NAD+,Samaglutide,GHK-CU,cagrilintide

    Location:

    1502A1, Building 4, Xinyuanxin Center, No. 3 Huaxin Road, Dongfeng Street, Licheng District, Jinan City, Shandong Province

    Payment Terms:

    TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    1

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    51-100

    Year of Establishment:

    2026

    Certifications:

    COA,COA,COA,COA,COA,COA,COA,COA,COA,COA,COA,COA

    COMPANY INTRODUCTION

    20 years of dedicated work in the peptide industry

    15 Years of Industry Experience

    We have been a high-tech company focused on the development, production, and marketing of various peptide products

     for 15 years. Through advanced laboratories and strict quality control, our internationally certified products are safe and 

    effective.


    Clients in Europe, the USA, Southeast Asia, and the Middle East

    As a global trading company, we serve clients across Europe, the USA, Southeast Asia, the Middle East, and beyond, providing

     customized solutions. Committed to "technology leading Health", we aim to innovate and deliver high-quality health products 

    worldwide.


    3,000sqm Factory with 60 Employees

    We have a factory covering 3,000 square meters and housing 60 employees to guarantee the highest quality all the time. We hired 

    three quality auditors with three years of experience. They meticulously inspect each item at every production stage.


    Contact Us Now

    Our products are exported to more than 130 countries and regions, which can be delivered fast within 5-14 days. We can provide

     OEM/ODM support to our customers. We have 10 professional after-sales staff to make 24-hour responses to our customers. 

    Contact us now to learn more. We hope to establish stable and strategic long-term business relationships with domestic and 

    foreign suppliers and customers, jointly pursuing a better future.


  • Weekly Price

    The chart shows the price trend of the product in the past 12 months.

  • Inquiry History
    10 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.