Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > Teriparatide acetate for Sale > Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping
Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping buy - large image1
Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping buy - image1
Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping buy - image2
Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping buy - image3
Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping buy - image4
Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping buy - image5
Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping buy - image6

Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping

TDS 14 Inquiries

Unit Price: Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

ShenZhen

Brand:

Tong Peptide

Packaging:

10 vials/box

Price valid (until):

2026-09-11

Company Type:
Manufactory
Location:
China
Payment Terms:
TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance
Qualification:
Main Products:

retatrutide,TB-500,GHK-CU,peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Name: Tina

    Whatsapp: +852 6576 7865

    Email: tina@tongpeptides.com


    We offer various types of peptides, about peptides, we can offer good quality, good price. Customers who have ordered our products (peptides) have received very good feedback. Reliable buyers around the world can contact us about peptides

    1. Ultra-low temperature freezing: Freeze the highly active ingredients at -196 degrees to put the active ingredients into a dormant state.

    2. Effective regeneration: Add the solvent to the powder when using it, and it can be effectively regenerated after mixing, ensuring the high activity and high stability of the product. We offer various types of peptides, and we can provide excellent quality and preferential prices for peptides. The feedback from customers who have ordered our products (peptides) is very good. Reliable buyers around the world can contact us for peptide matters. We offers an unparalleled combination of quality, performance and value. If you have any questions about this product or want to learn more about how it can benefit your business, please feel free to contact us. We are committed to providing excellent customer service and helping our customers achieve their business goals.We look forward to the opportunity to work with you and help you succeed.


    Store unopened lyophilized powder at ‑20℃, keep dry and away from light. Reconstitute with 0.9% BAC bacteriostatic water. After reconstitution, store at 2‑8℃ refrigeration. Gently swirl the vial to dissolve powder, do not shake violently. Avoid repeated freeze‑thaw cycles, aliquot is recommended for dissolved peptide solution.Shop Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping-Detailed Image 1
    Items Specifications
    Product Name TER10|10mg*10 vials
    Appearance White Lyophilized Powder
    Purity ≥99%
    CAS No.  

    52232-67-4

    Storage (Unopened) -20℃, Keep dry and away from light
    Storage (After reconstitution) 2-8℃ refrigerated, use within 7-12 days
    Solvent for reconstitution

    BAC water (Benzyl Alcohol 0.9%)

    Shelf life 3 Years
    MOQ 1 box(10 vials)
    • Why choose us?
    • Our Services

      1.Strictly control the process from raw materials to finished products.

      2.Customer first, we provide reasonable price, high quality products and timely delivery.

      3.Our delivery method is safe and fast.

      4.Quickly and clearly answer customer 's questions.

      If you place a large number of orders with us, we can give a price discount.Shop Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping-Detailed Image 2 Shop Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping-Detailed Image 3 Shop Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping-Detailed Image 4 Shop Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping-Detailed Image 5

    We accept Alibaba,Bitcoin,Bank and USDT payments.

    Orders placed on the same day will be shipped the next day.

    FAQ

    1.Do you ship internationally?

    Worldwide shipping options may be available depending on destination, product category, and local import rules. Please confirm your country with our team first.

    2.How should customers confirm legality?

    Customers are responsible for confirming that import, possession, research use, or any other intended use is lawful in their jurisdiction before requesting shipment.

    3.Can I request COA before confirming details?

    Yes. You can request available batch documentation, product information, and shipping details through WhatsApp before you confirm the order request.

    Super fast delivery and receipt time,only five or six daysShop Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping-Detailed Image 6 Shop Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping-Detailed Image 7

    All our peptides are e with certified high purity, reliable stable quality that cheap suppliers can’t match.
    We take full responsibility for customs clearance to avoid detention troubles for you.

    1. We are the source factory of materials, offering high quality and high purity with wholesale prices.
    2. We can deliver to any region, with dedicated delivery services, ensuring safety and speed.
    3. You can communicate with us for any product. Our products are diverse and we support customization to meet your needs as much as possible.
    4. We support various payment methods, and all details can be discussed.
    5. You can contact me for any questions. I will do my best to answer them for you.

    6 Price : We do not engagein price wars. Our first quotation may too expensive to you, please don't lose heart. Firstly, our quality can be guaranteed; Secondly, our tranportation efficiency and custome clearance rate can be guaranteed; Thirdly, we will provide you with the highest quality service, in any aspect.

    You get what you pay off, if you have any questions, i will have the answer.Shop Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping-Detailed Image 8 Shop Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping-Detailed Image 9

    Our company is a high-tech enterprise specializing in the research, production and sales of peptide products. With advanced laboratories and strict quality control systems, our products have obtained international certifications, ensuring safety and effectiveness.
    Our customers are located in Europe, the United States, Southeast Asia, the Middle East and other regions.

    Biotechnology Co., Ltd. is a high-tech enterprise specializing in the research, development, production, and sales of peptide products. With advanced laboratories and a rigorous quality control system, our products have obtained international certification, ensuring safety and efficacy.

    As a global trading company, we provide customized solutions for customers in Europe, the United States, Southeast Asia, the Middle East and many other regions. Adhering to the concept of "Technology leads to health", we are committed to innovation and strive to provide high-quality health products for global consumers.
    Business philosophy
    Based on the domestic market, we have increased investment in research and development, produced high-quality products, and promoted environmental protection and sustainable development through technology. At the same time, we actively expand the international market, sincerely serve society, and strive to become a modern, environmentally friendly, and advanced technology enterprise with global standards. Contact Us

    Our products have been exported to 130 countries and regions. We are committed to establishing stable, strategic and long-term partnerships with both domestic and international suppliers and customers, working together to create a brighter future.Shop Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping-Detailed Image 10 Shop Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping-Detailed Image 11 Shop Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping-Detailed Image 12

    Our advantage: Safe, effective and efficient customer service. Our products are produced quickly and safely. Provide samples before regular order. We focus on serving foreign customers, our products sell well in many countries. We ensure quality products and reasonable prices. We have good after-sales service, solve any type of problem, the goal is to make every customer satisfied with our company and get the best reputation.
    Constantly strive for high quality products, competitive prices, professional support, effective team, cooperative and honest cooperation, good after-sales workShop Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping-Detailed Image 13 Shop Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping-Detailed Image 14 Shop Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping-Detailed Image 15 Shop Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping-Detailed Image 16

      How to make an order?

    Send me message and let me know what you need with quantity , then i will calculate to you.


    WhatsApp+852 6576 7865

    ECHEMI Editorial Reference
    The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
    Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.

    Certificates
    • Teriparatide |TER10|Hot Selling |High >99% Quality|Factory Direct Supply|Fast Shipping Certificates 1 TDS

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Categories:

    Polypeptide

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    retatrutide,TB-500,GHK-CU,peptide

    Location:

    1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    501-1000

    Year of Establishment:

    2023

    Pharma Grade Peptides is your premium source for high-quality purified research peptides.

    We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

    Over the course of many years, we have empowered researchers and scientists to
    explore new avenues of scientific discovery.

  • Inquiry History
    14 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    United States

    teriparatide

    1 G Sep 6, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Russia

    Teriparatide

    1 G Sep 12, 2026
    Russia

    Teriparatide

    1 G Sep 12, 2026
    United States

    Teriparatide kit of 10 2mg vials

    1 MT Sep 7, 2026
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.