Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling
Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling buy - large image1
Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling buy - image1
Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling buy - image2
Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling buy - image3
Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling buy - image4
Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling buy - image5
Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling buy - image6

Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling

12 Inquiries

Unit Price:

$150-175/UNIT FOB

Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99.9%

Port:

Guangzhou

Packaging:

10 vials/box

Price valid (until):

2026-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide raw,Tirzepatide raw,TB500 raw

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      contact me  


    Name:  Amber

    Whatsapp:+852 6641 4306

    Email: jiez47967@gmail.com


      About Product  


       

      • Made of premium raw materials with high purity and low impurity. It has stable physical properties and excellent water solubility. Rich in biological activity with mild and efficient effect, consistent batch quality and easy storage. Widely used in biological scientific research and related experiments with stable supply and reliable quality.

        Peptide products offer diverse functional benefits across multiple scenarios:

        in health management, peptides support metabolic regulation (aiding in blood sugar control and healthy weight management for specific groups) and immune system modulation by enhancing the body's defense responses;

        in skincare, peptides promote skin barrier repair, boost collagen synthesis to reduce fine lines, and improve skin hydration and elasticity;

        in sports nutrition, peptides assist in muscle recovery by reducing post-exercise tissue damage and supporting muscle protein synthesis.


    Shop G75 High purity, low price, fast delivery, safe on time delivery-Detailed Image 1



    Purity: >99%
    Storage: Dry, dark, and at 0 - 4 C for the short term (days to weeks) or -20 C for the long term (months to years).
    Solubility: Soluble in DMSO
    Shipping Condition:

    Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.


    About us  


    Yiwu Weide Trading Co., LTD
    We are a company specializing in the research and development, as well as the supply of plant extracts, cosmetic raw materials and food additives. Our high-quality peproducts are widely used in the healthcare sector, and we hold an important position in the domestic market. We also export to Europe, the United States and Southeast Asia.

    The company adheres to the business philosophy of "pursuing excellent quality and emphasizing customer service", and is committed to providing customers with high-quality products and professional services. We have an experienced management team, who strictly control every aspect from raw material procurement, production, quality control to pre-sale and after-sale services, as well as logistics distribution, to ensure the safety, efficiency and timely delivery of the products.

    Our primary focus encompasses a range of products, including weight loss peptides, medicinal peptides, cosmetic peptides, and customized peptides. Notable among our weight loss peptide offerings are Semaglutide, Tirzepatide, Retatrutide, and others.


    Shop G75 High purity, low price, fast delivery, safe on time delivery-Detailed Image 2 Shop G75 High purity, low price, fast delivery, safe on time delivery-Detailed Image 3 Shop G75 High purity, low price, fast delivery, safe on time delivery-Detailed Image 4




      About ship  


    We can also recomend you the best shipping method to let you receive the products more safely and faster.
    Shop G75 High purity, low price, fast delivery, safe on time delivery-Detailed Image 5


    customer service


    1. 1.We commit to replying to all emails, messages, and inquiries within 24 hours (on business days). For urgent needs, we provide instant communication channels and proactively update you on order, production, and logistics progress.
    2. 2.Beyond standard products, we support customization based on your market regulations, certification requirements, packaging specs, and labeling design to ensure smooth market entry .
    3. 3.Delivery is not the end. We offer product quality tracking, quick complaint resolution, market feedback collection, and regular industry updates to help you optimize sales strategies for mutual growth.

    4. We offer flexible custom synthesis services, supported by an experienced R&D team. Whether you ’ re looking for novel peptide sequences, cosmetic-grade purity, or modified molecules (e.g., PEGylation, acetylation), we can deliver high-quality results on time.

      Our services include:
      • Custom peptide synthesis (mg to kg scale)
      • Peptide modifications and labeling
      • Small molecule synthesis
      • Project-based research and scale-up

      We work closely with our clients to ensure technical feasibility, fast delivery, and cost control throughout the development cycle.

    Shop 2026 Best Price Custom Label Peptides Lyophilized Powder 99 High Purity-Detailed Image 7 Shop 2026 Best Price Custom Label Peptides Lyophilized Powder 99 High Purity-Detailed Image 8

       

    ECHEMI Editorial Reference
    The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
    Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide raw,Tirzepatide raw,TB500 raw

    Location:

    Room 402, Unit 2, Building 23, Dalutou Village, Jiangdong Sub-district, Yiwu City, Jinhua City, Zhejiang Province (Self-declared)

    Year of Establishment:

    2025

    Established in 2025, Yiwu Weide Trading Company specializes in the research, development, production, and sales of peptide products, synthetic peptide amino acids, beauty and weight-loss products, and raw materials for cosmetics designed to reduce dark spots. The company possesses strong R&D capabilities, sophisticated synthesis technologies, and advanced quality control methods. It actively collaborates with major enterprises and manufacturers, adhering to the philosophy of industrial development to serve society and its customers. The company consistently prioritizes market demand, continuously developing high-tech beauty peptides for spot removal and wrinkle reduction. Its products are primarily exported to the United States, Europe, South Africa, Nigeria, and other countries and regions. With extensive export experience, the company ensures the safe delivery of its shipments.

  • Inquiry History
    12 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    United States

    teriparatide

    1 G Sep 6, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    United States

    Teriparatide kit of 10 2mg vials

    1 MT Sep 7, 2026
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.