 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.Factory price high purity

Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.Factory price high purity buy - large image1

Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.Factory price high purity buy - image1

Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.Factory price high purity buy - image2

Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.Factory price high purity buy - image3

Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.Factory price high purity buy - image4

Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.Factory price high purity

15 Inquiries

Unit Price:

$5/G FOB

Get Latest Price 

CAS No.:

52232-67-4

Grade:

Pharmaceutical

Content:

99%

Port:

HongKong

Packaging:

10mg/vial

Price valid (until):

2026-11-09

Contact Supplier

 Chat Now

HUATAI PEPTIDES

Company Type:

Trader

Location:

China

Payment Terms:

TT against B/L draft before shipment,100% TT in advance

Average Lead Time:

1 days

Qualification:

Main Products:

Tirzepatide,Retatrutide,NAD+,Samaglutide,GHK-CU,cagrilintide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Detail

We produce various peptides. Please feel free to inquire.

Name :Serena

Whatsapp/wechat:+85270949876

Email:serenahuatai@hotmail.com

Main Function

Items	Specifications
Brand	Synpeptide
Product Name	Teriparatide acetate
CAS No.
MF	C172H278N52O47S2
MW	3890.49792
Melting point	>205oC (dec.)
Storage temp	−20°C
Appearance	White powder
Grade	Pharmacy Grade
Application	Pharmaceutical Intermediate

Items	Specifications
Product Name	Teriparatide
CAS Number	52232-67-4
Appearance	White Powder

CAS 910463-68-2	Semaglutide
CAS 2023788-19-2	Tirzepatide
CAS 2381089-83-2	Retatrutide
CAS 1401708-83-5	Dihexa
CAS 121062-08-6	MTII, Melanotan II
CAS 307297-39-8

Teriparatide is used to treat bone loss ( osteoporosis) in people who have a high risk of getting fractures. It is similar to a natural hormone in your body ( parathyroid hormone). It works by increasing bone mass and strength. This effect helps to decrease the risk of getting a fracture.This medication is not recommended for use in children or young adults whose bones are still growing.

Product Detail

Shop mt1 10mg raw powder Melanotan 1 senwayer Factory price-Detailed Image 2

Welcome to contact me！

We offer various types of peptides, about peptides, we can offer good quality, good price. Customers who have ordered our products (peptides) have received very good feedback. Reliable buyers around the world can

Contact us

Name :Serena

Whatsapp/wechat:+85270949876

Email:serenahuatai@hotmail.com
Product Detail

Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 2

Under ideal, controlled conditions, Adipotide once showed promising advantages:

Highly Targeted and Direct: Unlike general weight-loss drugs that work systemically by suppressing appetite or boosting metabolism, it directly "destroys" the fat tissue itself, theoretically making it more efficient.
Potentially Fast-Acting: In monkey studies, significant body fat reduction was observed within weeks.

Product Detail

Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 3

Our main products include peptide products and pharmaceutical raw materials. We boast strong R&D capabilities, superb synthesis technology, and advanced quality control methods. We actively promote joint ventures and cooperation with major enterprises and manufacturers, serving society and users with the concept of industrial development. We always adhere to market demand orientation and continuously develop new high-tech chemical products and pharmaceutical intermediates.

I am very confident in the quality of our products, and many foreign customers have given high praise after receiving our goods. Our products are of excellent quality, and we firmly guarantee door-to-door delivery of your orders.

Corporate Culture:Strive for survival by quality, strive for development by competition

Corporate Philosophy:We always adhere to "integrity-based, customer first, high quality and efficiency" as the concept, based on "excellent quality, transparent price, punctual delivery, professional service" as the principle, meanwhile we can and will do our best to provide customers with the best service to repay customers.

Packaging Process:

Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 8

FQA

Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 9

Samaglutide Product Introduction

I. Basic Information
Name: Samaglutide
CAS No.: 910463-68-2
Molecular Formula: C₁₈₇H₂₉₁N₄₅O₅₉
Molecular Weight: 4113.58 Da
Structure: Long-acting GLP-1 receptor agonist, fatty acid modified, half-life approximately 7 days

Appearance: White lyophilized powder
Purity: ≥99% (HPLC-MS)

II. Mechanism of Action (GLP-1 monoreceptor agonist)
Glucose Control: Glucose-dependent insulinotropic effect, glucagon inhibition
Weight Loss: Delays gastric emptying, potent appetite suppression, reduces calorie intake
Cardiovascular Protection: Reduces the risk of major adverse cardiovascular events

III. Core Efficacy
Weight Loss
STEP 1: Average weight loss over 68 weeks 14–15% (approximately 15.5 kg)

Over 80% fat loss, muscle preservation

Blood sugar reduction

Type 2 diabetes: HbA1c reduction of 1.5–2.0%

Improved metabolism

Benefits include lowering blood pressure, improving blood lipids, and reducing fatty liver

Cardiovascular benefits

SELECT trial: 20% reduction in MACE risk in overweight/obese individuals

Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 10

Handling and Storage

Precautions for safe handling

Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

Conditions for safe storage, including any incompatibilities

Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

ECHEMI Editorial Reference

The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.

Basic Info

Product Name:

Teriparatide acetate

Other Name:

PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

CAS No.:

52232-67-4

Molecular Formula:

C172H278N52O47S2

InChIKeys:

BUUKFBVDKSFMHN-LKMAISLMSA-N

Molecular Weight:

3890.49792

EC Number:

640-978-1

Color/Form:

White to Off-White

HScode:

2937190000

Categories:

Bulk Drug Intermediates

Characteristics

Melting Point:

>205oC (dec.)

Water Solubility:

Soluble to 0.40 mg/ml in water

Critical Temperature & Pressure:

−20°C

See More Teriparatide acetate Properties 

Hazard Identification

Classification of the substance or mixture

Carcinogenicity, Category 2

Reproductive toxicity, Category 2

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Warning
Hazard statement(s)	H351 Suspected of causing cancer H361 Suspected of damaging fertility or the unborn child
Prevention	P203 Obtain, read and follow all safety instructions before use. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
Response	P318 IF exposed or concerned, get medical advice.
Storage	P405 Store locked up.
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

no data available

Handling and Storage

Precautions for safe handling

Conditions for safe storage, including any incompatibilities

Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

See More Teriparatide acetate Safety Data Sheet 

Seller Information

Business Type:
Trader

Main Products:
Tirzepatide,Retatrutide,NAD+,Samaglutide,GHK-CU,cagrilintide

Location:
1502A1, Building 4, Xinyuanxin Center, No. 3 Huaxin Road, Dongfeng Street, Licheng District, Jinan City, Shandong Province

Payment Terms:
TT against B/L draft before shipment,100% TT in advance

Average lead Time:
1 days

Total Annual Revenue:
$10 million-$25 million

Total Employees:
51-100

Year of Establishment:
2026

Company Certificates
- COA
- COA
- COA
- COA
- COA
- COA
- COA
- COA
- COA
- COA
- COA
- COA
COMPANY INTRODUCTION
20 years of dedicated work in the peptide industry
15 Years of Industry Experience
We have been a high-tech company focused on the development, production, and marketing of various peptide products
for 15 years. Through advanced laboratories and strict quality control, our internationally certified products are safe and
effective.

Clients in Europe, the USA, Southeast Asia, and the Middle East
As a global trading company, we serve clients across Europe, the USA, Southeast Asia, the Middle East, and beyond, providing
customized solutions. Committed to "technology leading Health", we aim to innovate and deliver high-quality health products
worldwide.

3,000sqm Factory with 60 Employees
We have a factory covering 3,000 square meters and housing 60 employees to guarantee the highest quality all the time. We hired
three quality auditors with three years of experience. They meticulously inspect each item at every production stage.

Contact Us Now
Our products are exported to more than 130 countries and regions, which can be delivered fast within 5-14 days. We can provide
OEM/ODM support to our customers. We have 10 professional after-sales staff to make 24-hour responses to our customers.
Contact us now to learn more. We hope to establish stable and strategic long-term business relationships with domestic and
foreign suppliers and customers, jointly pursuing a better future.

Inquiry History

15 Inquiries

Country	Product	Purchase Quantity	Date Posted
United States	Teriparatide	1 KG	May 28, 2026
United States	Teriparatide	10 MT	May 29, 2026
Bulgaria	teripatatide	1	May 17, 2026
Russia	teriparatide	100 MG	Feb 23, 2026
Kazakstan	Teriparatide	5 MG	Jan 2, 2026
Kazakstan	Teriparatide	5 MG	Jan 1, 2026
Kazakstan	teriparatide	1 KG	Nov 17, 2025
United Kingdom	Supply	1	Mar 5, 2024
Russia	Teriparatide	1 G	Sep 12, 2026
Russia	Teriparatide	1 G	Sep 12, 2026
United States	Teriparatide kit of 10 2mg vials	1 MT	Sep 7, 2026
Germany	Teriparatide Acetate	5 MG	Jul 5, 2026
Kazakstan	Teriparatide	1 KG	Jan 4, 2026
United States	teriparatide	1 G	Sep 6, 2026
Belgium	Erdafitinib	10 G	Sep 20, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
teriparatide acetate	Tech Grade/99	$16/KG EXW	DAHAI BIOCHEM LTD	Inquiry
Teriparatide cas52232-67-4 high purity 99% peptide for osteoporosis	Pharmaceutical Grade/99	$1/G FOB		Inquiry
Teriparatide high pure 99% raw material powder CAS 52232-67-4	Pharmaceutical Grade/99	$1/G FOB	Hubei Meisang Trading Co.,Ltd	Inquiry
High Grade Peptide Powder CAS 52232-67-4 Teriparatide Acetate Blend Peptide 10mg Vials	Pharmaceutical Grade/99	$10/UNIT FOB	Jinan Pingxing Trading Co., Ltd.	Inquiry
Hot Selling High Quality Teriparatide CAS NO 52232-67-4 TER10	Pharmaceutical Grade/99	$125/MT FOB	Shengyufan International Trade Co., Ltd.	Inquiry

Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.Factory price high purity

Product Description

Seller Information

Inquiry History

Precautions for safe handling

Conditions for safe storage, including any incompatibilities

Classification of the substance or mixture

GHS label elements, including precautionary statements

Other hazards which do not result in classification

Precautions for safe handling

Conditions for safe storage, including any incompatibilities

More Choices Find All Products for Sale 

Related Searches

More from this Seller