Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Antiemetics > LL-37 for Sale > High-quality peptide products AK100 NJ500 Thymosin Alpha DS5 CU50+TB10+BC10+KPV10 BT10 CS10 G5K XA10
High-quality peptide products AK100  NJ500  Thymosin Alpha  DS5  CU50+TB10+BC10+KPV10  BT10  CS10  G5K  XA10 buy - large image1
High-quality peptide products AK100  NJ500  Thymosin Alpha  DS5  CU50+TB10+BC10+KPV10  BT10  CS10  G5K  XA10 buy - image1
High-quality peptide products AK100  NJ500  Thymosin Alpha  DS5  CU50+TB10+BC10+KPV10  BT10  CS10  G5K  XA10 buy - image2
High-quality peptide products AK100  NJ500  Thymosin Alpha  DS5  CU50+TB10+BC10+KPV10  BT10  CS10  G5K  XA10 buy - image3
High-quality peptide products AK100  NJ500  Thymosin Alpha  DS5  CU50+TB10+BC10+KPV10  BT10  CS10  G5K  XA10 buy - image4
High-quality peptide products AK100  NJ500  Thymosin Alpha  DS5  CU50+TB10+BC10+KPV10  BT10  CS10  G5K  XA10 buy - image5
High-quality peptide products AK100  NJ500  Thymosin Alpha  DS5  CU50+TB10+BC10+KPV10  BT10  CS10  G5K  XA10 buy - image6

High-quality peptide products AK100 NJ500 Thymosin Alpha DS5 CU50+TB10+BC10+KPV10 BT10 CS10 G5K XA10

TDS 3 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

SHENZHEN

Brand:

sc

Packaging:

5 mg /10 mg / 15 mg / 20 mg / 30 mg / 10 tubes per box

Price valid (until):

2026-12-11

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Inquiry History

  • Description



    Business Manager: Anne
    WhatsApp: +852 6462 7346

      Product Detail  


    Why Choose Us
    •High quality products: We have rich experience in production and processing, strict quality inspection.

    •Reasonable prices: Factory direct, reasonable price and negotiable.

    •Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications

    •Quick response: We will reply to your message within 24 hours.

    •Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.Shop Hot products 322 RT5  Snap-8  5-amino-  2S10  IGF-1L  Lemon Bottle  H10-Detailed Image 1

    FAQ
    Q1.Can I have a sample order?

    A: Yes, welcome to place an sample order to check quality or market.

    Q2.What's the sample and goodslead time?

    A:The stock sample for l day,custom sample for 7-10 days,bulk order for 20-25 days.

    Q3.Do you have any MOQ limit?

    A:yes,the MOQ is 100pcs but any trial order is welcome.

    Q4.How do you ship the goods and how long does it take to arrive?

    A:According to your order quantity,usually ship by sea or by air and by express,20-30 days by sea,5-7 days by air and 3-5 days byexpress.

    Q5.How to proceed an order?

    A: Firstly let us know your requirements. Secondly We quote according to your requirements or our suggestions. Thirdly customer confirm the artworks and pay deposit for formal order.Fourthly We arrange the production & shipment then you pay balance to us.

    Q6.Is it OK to print my logo on the product?

    A: Yes.Please provide the logo Al file so that our designer can make the mock up for you approval.

    Q7: Can you support custom packing?

    A: Sure,custom poly bag with warning text,gift box or display box is welcome.es.Shop Hot products 322 RT5  Snap-8  5-amino-  2S10  IGF-1L  Lemon Bottle  H10-Detailed Image 2

    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

    The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.Shop Hot products 322 RT5  Snap-8  5-amino-  2S10  IGF-1L  Lemon Bottle  H10-Detailed Image 3

    Why choose us


    We ship to Asia, Australia, Central and South America, Eastern Europe, the Middle East/Africa, North America, and Western Europe.

    Our peptide products are of superior quality and feature advanced technology. We provide not only excellent shipping services but also worry-free after-sales support. With over a decade of experience in the peptide industry, we remain committed to the principle of integrity in serving our customers. We also utilize dedicated shipping routes to ensure 100% safe delivery.Shop Hot products 322 RT5  Snap-8  5-amino-  2S10  IGF-1L  Lemon Bottle  H10-Detailed Image 4



    Factory transportation

    Shop Hot products 322 RT5  Snap-8  5-amino-  2S10  IGF-1L  Lemon Bottle  H10-Detailed Image 5

    • Shop Hot products 322 RT5  Snap-8  5-amino-  2S10  IGF-1L  Lemon Bottle  H10-Detailed Image 6 Shop Hot products 322 RT5  Snap-8  5-amino-  2S10  IGF-1L  Lemon Bottle  H10-Detailed Image 7

      1. Ultra-High Purity
      Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

      2.Accurate Dosing & Consistency
      Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

      3.Endotoxin-Free & Sterile Processing
      Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

      4. Advanced Manufacturing Capabilities

      Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

      Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.

      5. Innovation & Customer Commitment

      Reliable Supply Chain: Competitive pricing & timely global delivery.

      Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.Shop Manufacturer's price BBG70  RT50  SS-31  Lemon Bottle  BC10  2S50-Detailed Image 8 Shop Manufacturer's price BBG70  RT50  SS-31  Lemon Bottle  BC10  2S50-Detailed Image 9 Shop Hot products 322 RT5  Snap-8  5-amino-  2S10  IGF-1L  Lemon Bottle  H10-Detailed Image 10 Shop Hot products 322 RT5  Snap-8  5-amino-  2S10  IGF-1L  Lemon Bottle  H10-Detailed Image 11 Shop Hot products 322 RT5  Snap-8  5-amino-  2S10  IGF-1L  Lemon Bottle  H10-Detailed Image 12

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    High-quality peptide products AK100 NJ500 Thymosin Alpha DS5 CU50+TB10+BC10+KPV10 BT10 CS10 G5K XA10 is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • High-quality peptide products AK100  NJ500  Thymosin Alpha  DS5  CU50+TB10+BC10+KPV10  BT10  CS10  G5K  XA10 Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Antiemetics

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    20 years of production experience in peptide products

    Safe and unobstructed shipping channels|High quality guaranteed|

    Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.


  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.