PNC-27 research peptide |CAS 1159861-00-3 |API |life science supplier |"99% purity peptide supplier |research peptide

Structural Origin

PNC-27 is designed based on two main components:

(1) p53 Protein Fragment

It contains the HDM-2 (also known as MDM2) binding region of the human tumor suppressor protein p53:

p53 amino acids 12–26

This region is involved in the interaction between p53 and HDM-2.

(2) Cell-Penetrating / Membrane-Targeting Sequence

PNC-27 is also linked with a membrane-penetrating related sequence, which provides membrane-targeting properties in research studies.

Complete sequence:

PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

Research Mechanism

The primary research focus of PNC-27 is:

HDM-2 (MDM2)-Related Interaction

HDM-2 is an important regulatory protein in the p53 signaling pathway.

Under normal conditions:

p53 ↔ HDM-2 regulatory relationship

When HDM-2 is overexpressed, it may affect the normal activity and regulation of p53.

Researchers designed PNC-27 to study its potential interaction with HDM-2-related structures through:

p53 binding domain + membrane-targeting structure

Experimental Research Areas

Current research on PNC-27 mainly focuses on:

① Tumor Cell Membrane Interaction

Studies have investigated whether PNC-27 can interact with HDM-2-related structures on the cell membrane in certain experimental models.

② Membrane Pore Formation Studies

Some in vitro studies have observed:

Changes in cell membrane permeability
Alterations in membrane structure
Cell lysis phenomena

The related mechanisms remain under investigation.

③ Tumor Model Research

Research models include:

Leukemia cell models
Pancreatic cancer cell models
Melanoma cell models
Other cancer cell lines

PNC-27 is mainly used for exploring molecular mechanisms in laboratory research.

Q&A

Q: When can I receive the package?

A: It will be shipped as soon as possible after payment, and the shipping time is generally 7 to 15 days.

Q: What is the minimum amount I can order?

A: The minimum quantity we can order is 1 box, which contains 10 vials.

Q:How about the price? Can you make it cheaper?

A:We always take the customer's benefit as the top priority. Price is negotiable under different conditions, we are assuring you to get the most competitive price.

Q: How do i keep the peptides when i receive it ?

A: Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

Company Profile

HKX is a reliable manufacturer and exporter of peptide raw materials.

We have strong R&D capabilities and advanced production facilities. Our products cover various synthetic peptides and related raw materials, which are widely used in scientific research and pharmaceutical development. Every batch of goods undergoes rigorous laboratory testing to meet international quality standards.

We have years of international trade experience and a complete logistics system. Neutral packaging is used for all goods to comply with international shipping regulations. We provide flexible order solutions for customers, from small trial orders to large bulk purchases.

We provide:

✔ High purity raw materials
✔ Strict quality inspection
✔ Competitive factory pricing
✔ Fast response service
✔ Global shipping support
✔ Professional after-sales service

Sticking to the philosophy of Quality Priority and Customer Oriented, we sincerely welcome customers from all over the world to negotiate business and create win-win cooperation.

Contact Us

Please contact us if you have any doubts regarding our products or enterprise.

We provide dedicated service for all clients.