Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL-37|154947-66-7|LL-37 peptide supplier |LL-37 wholesale |cell research peptide |immune peptide
LL-37|154947-66-7|LL-37 peptide supplier  |LL-37 wholesale  |cell research peptide  |immune peptide buy - large image1
LL-37|154947-66-7|LL-37 peptide supplier  |LL-37 wholesale  |cell research peptide  |immune peptide buy - image1
LL-37|154947-66-7|LL-37 peptide supplier  |LL-37 wholesale  |cell research peptide  |immune peptide buy - image2
LL-37|154947-66-7|LL-37 peptide supplier  |LL-37 wholesale  |cell research peptide  |immune peptide buy - image3
LL-37|154947-66-7|LL-37 peptide supplier  |LL-37 wholesale  |cell research peptide  |immune peptide buy - image4
LL-37|154947-66-7|LL-37 peptide supplier  |LL-37 wholesale  |cell research peptide  |immune peptide buy - image5
LL-37|154947-66-7|LL-37 peptide supplier  |LL-37 wholesale  |cell research peptide  |immune peptide buy - image6

LL-37|154947-66-7|LL-37 peptide supplier |LL-37 wholesale |cell research peptide |immune peptide

TDS 3 Inquiries

Unit Price:

$10/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GUANGZHOU

Brand:

HKX

Packaging:

5mg 10mg

Price valid (until):

2027-02-01

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Semaglutide,Retatrutide,MOTS-C,GHK-CU,MT-2

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Please contact me :Anna
    Whatsapp:+852 56821040
    Email:Annahkx@outlook.com

    1.   We supply high-purity research-grade lyophilized peptide powder peptide, available in lyophilized powder form in sterile vials. All batches are HPLC-tested to ensure purity ≥99%。
    Items Specifications
    Product Name LL-37
    CAS No. 154947-66-7
    Purity 99%
    Specification 5mg 10mg
    Appearance Lyophilized Powder

    Mechanism of Action


    (1) Antimicrobial Activity

    LL-37 belongs to the family of Antimicrobial Peptides (AMPs).

    ① Disruption of Microbial Membrane Structures

    Due to its positive charge, LL-37 can:

    Bind to negatively charged microbial membranes
    Insert into lipid bilayers
    Form membrane pores
    Cause leakage of intracellular contents

    Research has shown that LL-37 exhibits activity against various microorganisms, including:

    Gram-positive bacteria
    Gram-negative bacteria
    Certain fungi


    (2) Immunomodulatory Effects

    LL-37 is not only an antimicrobial peptide; it also plays a role in immune signaling regulation.

    Research areas include:

    Regulation of inflammatory factor release
    Recruitment of immune cells
    Modulation of innate immune responses

    LL-37 can interact with receptors such as FPRL1/FPR2, affecting:

    Neutrophil activity
    Monocyte responses
    T-cell migration



     Tissue Repair Research


    LL-37 is also widely studied as a repair-associated antimicrobial peptide.

    Research suggests that it may participate in:


    ① Wound Healing

    Including:

    Keratinocyte migration
    Epithelial repair
    Angiogenesis


    ② Cell Proliferation Signaling

    Studies investigate its effects on:

    Fibroblasts
    Epithelial cells
    Tissue regeneration environments


    Main Research Applications



    A. Anti-Infection Research

    Research areas include:

    Novel antimicrobial strategies
    Antibiotic-resistant bacteria
    Biofilm formation


    B. Immunology Research

    Including:

    Innate immunity
    Inflammatory regulation
    Host defense mechanisms


    C. Skin and Tissue Repair Research

    Research focuses on:

    Wound healing
    Skin barrier function
    Epithelial regeneration


    D. Biofilm Research

    LL-37 is used to study its effects on:

    Bacterial aggregation
    Biofilm formation
    Microbial adhesion

    Shop LL-37|154947-66-7|LL-37 peptide supplier  |LL-37 wholesale  |cell research peptide  |immune peptide-Detailed Image 1 Shop LL-37|154947-66-7|LL-37 peptide supplier  |LL-37 wholesale  |cell research peptide  |immune peptide-Detailed Image 2 Shop LL-37|154947-66-7|LL-37 peptide supplier  |LL-37 wholesale  |cell research peptide  |immune peptide-Detailed Image 3 Shop LL-37|154947-66-7|LL-37 peptide supplier  |LL-37 wholesale  |cell research peptide  |immune peptide-Detailed Image 4 Shop LL-37|154947-66-7|LL-37 peptide supplier  |LL-37 wholesale  |cell research peptide  |immune peptide-Detailed Image 5 Shop LL-37|154947-66-7|LL-37 peptide supplier  |LL-37 wholesale  |cell research peptide  |immune peptide-Detailed Image 6

    Q&A


    Q: When can I receive the package?

    A: It will be shipped as soon as possible after payment, and the shipping time is generally 7 to 15 days.

    Q: What is the minimum amount I can order?

    A: The minimum quantity we can order is 1 box, which contains 10 vials.

    Q:How about the price? Can you make it cheaper?

    A:We always take the customer's benefit as the top priority. Price is negotiable under different conditions, we are assuring you to get the most competitive price.

    Q: How do i keep the peptides when i receive it ?

    A: Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.


    Company Profile


    HKX is a reliable manufacturer and exporter of peptide raw materials.


    We have strong R&D capabilities and advanced production facilities. Our products cover various synthetic peptides and related raw materials, which are widely used in scientific research and pharmaceutical development. Every batch of goods undergoes rigorous laboratory testing to meet international quality standards.


    We have years of international trade experience and a complete logistics system. Neutral packaging is used for all goods to comply with international shipping regulations. We provide flexible order solutions for customers, from small trial orders to large bulk purchases.


    We provide:

    ✔ High purity raw materials
    ✔ Strict quality inspection
    ✔ Competitive factory pricing
    ✔ Fast response service
    ✔ Global shipping support
    ✔ Professional after-sales service


    Sticking to the philosophy of Quality Priority and Customer Oriented, we sincerely welcome customers from all over the world to negotiate business and create win-win cooperation.

    Shop HIGH-Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 9 Shop HIGH-Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 10

    Shop LL-37|154947-66-7|LL-37 peptide supplier  |LL-37 wholesale  |cell research peptide  |immune peptide-Detailed Image 9 Shop LL-37|154947-66-7|LL-37 peptide supplier  |LL-37 wholesale  |cell research peptide  |immune peptide-Detailed Image 10


    Contact Us


    Please contact us if you have any doubts regarding our products or enterprise.

    We provide dedicated service for all clients.

    Shop LL-37|154947-66-7|LL-37 peptide supplier  |LL-37 wholesale  |cell research peptide  |immune peptide-Detailed Image 11

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL-37|154947-66-7|LL-37 peptide supplier |LL-37 wholesale |cell research peptide |immune peptide is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • LL-37|154947-66-7|LL-37 peptide supplier  |LL-37 wholesale  |cell research peptide  |immune peptide Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Semaglutide,Retatrutide,MOTS-C,GHK-CU,MT-2

    Location:

    203, NO. 88 Zhongxin North Road, Hangzhou Avenue Sub-district, Binhai New Area, Tianjin

    Payment Terms:

    TT against copy of documents,D/P,D/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    12

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    51-100

    Year of Establishment:

    2026

       Our company is a professional enterprise engaged in the chemical industry for many years, specializing in the import and export of chemical raw materials, fine chemicals, industrial additives, and related products.
       With a well-established supply chain system and strict quality control standards, we integrate high-quality manufacturing resources to ensure stable product quality and reliable supply. Our product portfolio covers general chemicals, fine chemicals, rubber and plastic raw materials, water treatment chemicals, and other related categories, serving both domestic and international markets.
       Adhering to the principles of integrity, quality first, and mutual benefit, we strictly control product quality and delivery timelines. We provide comprehensive one-stop foreign trade solutions, including product sourcing, customized selection, logistics coordination, and customs clearance services according to customer requirements.
       Leveraging extensive industry experience and a well-developed global sales network, we are committed to meeting diverse international procurement needs. We aim to build a stable and trustworthy bridge for global chemical trade and establish long-term, sustainable partnerships with clients worldwide.
  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.