 Home > Biochemical Engineering > Polypeptide > Teriparatide acetate for Sale > High Quality Lyophilized Powder Customs Made Peptides Teriparatide with best price

High Quality Lyophilized Powder Customs Made Peptides Teriparatide with best price buy - large image1

High Quality Lyophilized Powder Customs Made Peptides Teriparatide with best price

10 Inquiries

Unit Price:

$60-70/UNIT FOB

Get Latest Price 

CAS No.:

52232-67-4

Grade:

Reagent Grade

Content:

99%

Port:

Shenzhen, Shanghai

Brand:

T&L

Packaging:

10vials/box

Price valid (until):

2026-11-15

Contact Supplier

 Chat Now

T&L Biosciences

Company Type:

Manufactory

Location:

China

Qualification:

Main Products:

Peptide,Pharmaceutical raw powder

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Detail

We supply APIs, pharmaceutical intermediates, and functional peptide materials for research, supporting everything from sample testing and small-batch trial orders to bulk procurement.

We offer:

COA and product specifications
Various specifications and packaging options
Bulk purchase quotes
International shipping and logistics tracking
Long-term, stable supply services
Contact Us

WhatsApp / Telegram: +1 605 633 3333

Email: tail333398@gmail.com

FAQ

Q: What is the minimum order quantity (MOQ)?
A: It depends on the product; the standard MOQ is usually 100g, though trial orders of 10g or 20g are available for some products.

Q: Can you provide samples?
A: Yes, free samples are available for some products (shipping costs are borne by the customer).

Q: Are there discounts for bulk orders?
A: Yes. Please provide the product name, quantity, and destination country, and we will provide an accurate quote.

Q: How soon will the order ship?
A: In-stock items usually ship within 1–3 business days after payment confirmation, and tracking information will be provided.

Q: How long does international shipping take?

A: Shipping time depends on the destination country and local delivery conditions. Generally, international shipping takes about 5–12 business days.

Q: What payment methods do you accept?
A: We accept T/T, Wise, Zelle, USDT, BTC, etc.

Q: How do I place an order?
A: Please send us the product name, order quantity, specifications, and destination country; we will then confirm the price, stock availability, and shipping arrangements.

Shop High Quality Lyophilized Powder Customs Made Peptides Teriparatide with best price-Detailed Image 1

Teriparatide
mediates bone metabolism by inhibiting osteoblast apoptosis, activating bone lining cells, and enhancing osteoblast differentiation. By regulating the adenylyl cyclase-cyclic adenosine monophosphate-protein kinase A conduction pathway, it intermittently stimulates the PHT-Ⅰ receptor on the surface of osteoblasts, bone lining cells and bone marrow stromal stem cells to promote the differentiation of osteoblasts and prolong osteogenesis. Cell lifespan; stimulates the proliferation of osteoblast cell lines through the phosphate C-cytoplasmic calcium ion-protein kinase C signaling pathway; reduces the differentiation of stromal cells into adipocyte lines by inhibiting the transactivation activity of PPARγ and increases the number of osteoblasts Increase; indirectly regulate bone growth by regulating cytokines, for example, it can induce iGF-1 to bind to osteoblasts, thereby promoting bone formation; regulate the process of bone formation through the Wnt signaling pathway, thereby increasing bone formation.

Company Profile:

Laboratory Display:

Modes of Transport:

Packaging Process:

Payment Methods:

ECHEMI Editorial Reference

Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.

Research & Reference Note

High Quality Lyophilized Powder Customs Made Peptides Teriparatide with best price is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Authoritative sources

Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

Basic Info

Product Name:

Teriparatide acetate

Other Name:

PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

CAS No.:

52232-67-4

Molecular Formula:

C172H278N52O47S2

InChIKeys:

BUUKFBVDKSFMHN-LKMAISLMSA-N

Molecular Weight:

3890.49792

EC Number:

640-978-1

Color/Form:

White to Off-White

HScode:

2937190000

Categories:

Polypeptide

Characteristics

Melting Point:

>205oC (dec.)

Water Solubility:

Soluble to 0.40 mg/ml in water

Critical Temperature & Pressure:

−20°C

See More Teriparatide acetate Properties 

Hazard Identification

Classification of the substance or mixture

Carcinogenicity, Category 2

Reproductive toxicity, Category 2

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Warning
Hazard statement(s)	H351 Suspected of causing cancer H361 Suspected of damaging fertility or the unborn child
Prevention	P203 Obtain, read and follow all safety instructions before use. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
Response	P318 IF exposed or concerned, get medical advice.
Storage	P405 Store locked up.
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

no data available

Handling and Storage

Precautions for safe handling

Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

Conditions for safe storage, including any incompatibilities

Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

See More Teriparatide acetate Safety Data Sheet 

Seller Information

Business Type:
Manufactory

Main Products:
Peptide,Pharmaceutical raw powder

Location:
No. 188 Kaiyuan Avenue, Science City, Guangzhou High-tech Industrial Development Zone, Huangpu District, Guangzhou

Payment Terms:
100% TT in advance

Average lead Time:
15

Total Annual Revenue:
$2.5 million-$5 million

Total Employees:
11-50

Year of Establishment:
2020

T&L Biosciences is a modern biotechnology enterprise specializing in the R&D, production, and global supply of active pharmaceutical ingredients (APIs), pharmaceutical intermediates, plant extracts, and functional ingredients. Our products serve a wide range of sectors—including pharmaceutical R&D, nutrition and health, cosmetics, dietary supplements, and the food industry—providing reliable, professional ingredient supply services to overseas brands, distributors, research institutions, and manufacturers.

We operate a standardized production and processing system; our facilities are designed according to modern production management principles and feature dedicated zones for raw material handling, synthesis and extraction, refining and processing, quality testing, packaging, and warehousing. Through standardized workflows and comprehensive process management, we effectively control every stage—from raw material procurement and production to quality testing, storage, and export—ensuring consistent product quality and efficient order fulfillment.

T&L Biosciences prioritizes quality management and technological innovation. We are equipped with professional testing, analysis, and R&D instrumentation, and maintain a robust quality control system covering raw materials, production processes, and finished products. We offer a range of services tailored to client needs, including specific product specifications, testing reports, sample testing, custom development, and bulk supply.

Leveraging a mature supply chain and extensive international trade experience, we have established a global sales and service network, exporting products to North America, Europe, Southeast Asia, the Middle East, and other international markets. Committed to quality, driven by technology, and focused on long-term partnerships, we continuously provide global customers with stable, efficient, and competitive ingredient solutions.

Inquiry History

10 Inquiries

Country	Product	Purchase Quantity	Date Posted
United States	Teriparatide	1 KG	May 28, 2026
Russia	teriparatide	100 MG	Feb 23, 2026
Kazakstan	Teriparatide	1 KG	Jan 4, 2026
Kazakstan	Teriparatide	5 MG	Jan 1, 2026
Kazakstan	teriparatide	1 KG	Nov 17, 2025
Germany	Teriparatide Acetate	5 MG	Jul 5, 2026
United States	Teriparatide	10 MT	May 29, 2026
Bulgaria	teripatatide	1	May 17, 2026
Kazakstan	Teriparatide	5 MG	Jan 2, 2026
United Kingdom	Supply	1	Mar 5, 2024

Post an enquiry for this product

High Quality Lyophilized Powder Customs Made Peptides Teriparatide with best price

Product Description

Seller Information

Inquiry History

Classification of the substance or mixture

GHS label elements, including precautionary statements

Other hazards which do not result in classification

Precautions for safe handling

Conditions for safe storage, including any incompatibilities

Related Products

Related Searches