Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price.
LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price. buy - large image1
LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price. buy - image1
LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price. buy - image2
LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price. buy - image3
LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price. buy - image4
LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price. buy - image5
LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price. buy - image6

LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price.

TDS 3 Inquiries

Unit Price:

$95/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Laboratory Grade

Content:

99%

Port:

guangzhou

Brand:

Novio

Packaging:

5mg*10vials

Price valid (until):

2026-09-18

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides,Cosmetic Raw Materials,Pharmaceutical Intermediates

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Name: callie
    Whatsapp:852 46277864
    Email:calliegarrett33@gmail.com

    Bioactive 
    LL37 (Human cathelicidin, Ropocamptide) is an antimicrobial peptide related to cathelicidin, with potent chemotactic and immunomodulatory properties. Ll-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing. The importance of peptides: Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.
    Shop LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price.-Detailed Image 1 Shop LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price.-Detailed Image 2 Shop LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price.-Detailed Image 3
    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question. The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever. we specialize in weight loss packages for anyone looking for a total body transformation using a customized peptide package that is tailored just for your body. Our peptides have been around for decades but only to cater to the rich and famous. But now, we have brought their successful, customized treatments to the general public. Patients begin to see results and feel the effects in as quick as three weeks, transforming their bodies and feeling stronger and more energetic. Let us help you get your edge back. This program covers everything from fat loss to introductory muscle building. If you have struggled to get weight off and keep it off, this may be a great option for you! These products are APIs (Active Pharmaceutical Ingredient) and not a finished drug.  It is intended strictly for research and laboratory use only. Buyers are required to fully comply with all applicable laws and regulations regarding the handling and use of this material.

    Shop LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price.-Detailed Image 4 Shop LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price.-Detailed Image 5

    Items Specifications
    Product Name LL‑37
    CAS Number 154947-66-7
    Amino Acid Sequence [LL-37, 37 aa]
    Purity  ≥99% (HPLC)
    Appearance White to off‑white lyophilized powder
    Solubility Soluble in water, 10 mM acetic acid
    Storage Condition  Short‑term: ‑20 °C

    Long‑term: ‑80 °C, avoid repeated freeze‑thaw
    Note For research use onl

    Shop LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price.-Detailed Image 6 Shop LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price.-Detailed Image 7 Shop LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price.-Detailed Image 8 Shop LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price.-Detailed Image 9 Shop LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price.-Detailed Image 10 Shop LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price.-Detailed Image 11

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates
    • LL37, high quality, 99% purity, CAS No. 154947-66-7, factory direct price. Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides,Cosmetic Raw Materials,Pharmaceutical Intermediates

    Location:

    Room 1359, Room 103, Building Jia 19, Jixiang Garden, Tongzhou District, Beijing

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.