 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Glucagon for Sale > GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial factory direct supply, door-to-door delivery.

GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial factory direct supply, door-to-door delivery. buy - large image1

GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial factory direct supply, door-to-door delivery. buy - image1

GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial factory direct supply, door-to-door delivery.

TDS 4 Inquiries

Unit Price:

$20/KG FOB

Get Latest Price 

CAS No.:

16941-32-5

Grade:

Pharmaceutical

Content:

99.5%

Port:

SHENZHEN

Brand:

KSD

Packaging:

vial/kit

Price valid (until):

2026-11-17

Contact Supplier

 Chat Now

Jinan Kangshengda Technology Co., Ltd.

Company Type:

Trader

Location:

China

Qualification:

Main Products:

Semaglutide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Contact Information

Name: Lumi
WhatsApp: +85262361799
Email Address: 1316284917@qq.com

Factory Overview

Jinan Kangshengda Technology Co., Ltd. in Jinan High-tech Zone specializes in active peptide raw materials and supporting biological consumables. With years of industry experience, we supply functional peptides and lab consumables, delivering reliable products and one-stop procurement solutions for global customers.
We enforce rigorous quality control to ensure peptide purity and stability, addressing challenges such as deactivation and gelation. Supported by Jinan’s logistics advantages, we operate mature domestic and cross-border supply chains, offering flexible procurement, split delivery and customized cross-border shipping plans.
Adhering to integrity and win-win cooperation, we provide full pre- and after-sales technical support. Our market covers China and is expanding to the Americas, Europe and Latin America. We will keep enriching our peptide product range and improving supply services to be a trusted global peptide supplier.
Our modern peptide factory handles synthesis, purification and lyophilization. With clean workshops and advanced equipment, we stably produce mainstream GLP‑1 peptides with consistent purity ≥98%. All lyophilized vial products are for research use only. We offer customizable 20 mg/30 mg specifications (10 vials/box) and custom peptide services for research institutions and biotech enterprises worldwide.

Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 1

Product Detail

Product Form: White to off‑white lyophilized powder, supplied in vials as research‑grade peptide raw material.
Mechanism of Action: It mimics endogenous natural GnRH molecules in organisms and binds to pituitary receptors. It is applied in research on the secretion pathways of luteinizing hormone (LH) and follicle‑stimulating hormone (FSH), and widely used in laboratory mechanistic studies for endocrinology and reproductive physiology.
Product Advantages: Acetate salt modification improves peptide water solubility and storage stability. Tested by HPLC, the product meets research‑grade purity standards.
Solubility: Soluble in water and dilute aqueous acid solutions. It shows better stability under weakly acidic conditions, while strong alkaline environments may trigger peptide chain degradation and inactivation.
Storage Conditions: Store unopened lyophilized powder at ‑20 °C in dark and dry conditions; avoid repeated freeze‑thaw cycles. Reconstituted solution should be refrigerated at 2‑8 °C, used within a short period and must not be refrozen.
Application Scope: For in‑vitro laboratory research only, used for mechanistic investigations at cellular and animal levels.

Important Statement: For laboratory research use only. Not for human or animal administration. Not intended as pharmaceutical products, health‑care products or dietary supplements.

Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 4

Items	Specifications
Category	Peptides
Bottle Color	Transparent
Purity	99%
Specification	2mg,

What is a peptide?

Peptides are small molecules that lie between amino acids and proteins. They have a smaller molecular weight and do not require decomposition. They can be directly absorbed and utilized by the human body, with a much higher utilization rate than ordinary proteins.

Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 5

Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 6

Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 8

Peptide classification

Peptides are mainly classified based on their molecular structure into large molecule polypeptides, small molecule oligopeptides, as well as dipeptides and tripeptides. According to their application directions, they can be further divided into two categories: cosmetic peptides and health-promoting active peptides.

Health-promoting active peptides can be rapidly absorbed by the digestive system and participate in body metabolism. They can repair body cells, regulate immunity, alleviate fatigue and weakness, and also regulate blood sugar and lipid levels, nourish the stomach and intestines, repair the mucosa, slow down the aging of body functions, and are suitable for the daily treatment of people with sub-health conditions.

Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 9

Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 10

ECHEMI Editorial Reference

White or almost white powderProduced by the α cells of the islands of Langerhans and also by the gastric mucosa. It is opposite in effect to insulin. It appears to be a straight-chain polypeptide with a molecular weight of approximately 3500. Small amounts have been detected in commproduced by recombinant DNA technology ismarketed by Novo Nordisk (glucagon [recombinant] hydrochloride,GlucaGen HypoKit, GlucaGen Diagnostic Kit)and by Eli Lilly (glucagon [recombinant] Emergency Kit). The hypergly

Research & Reference Note

GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial factory direct supply, door-to-door delivery. is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Authoritative sources

Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

Certificates

Basic Info

Product Name:

Glucagon

Other Name:

GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN

CAS No.:

16941-32-5

Molecular Formula:

C153H225N43O49S

InChIKeys:

MASNOZXLGMXCHN-ZLPAWPGGSA-N

Molecular Weight:

3482.75

Exact Mass:

3480.615723

EC Number:

232-708-2

HScode:

2937190000

Categories:

Bulk Drug Intermediates

Characteristics

PSA:

1564.04000

XLogP3:

-6.01

Appearance:

powder

Density:

1.53±0.1 g/cm3(Predicted)

Refractive Index:

1.682

Water Solubility:

Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.

Storage Conditions:

−20°C

See More Glucagon Properties 

Hazard Identification

Classification of the substance or mixture

Skin sensitization, Category 1

Acute toxicity - Category 4, Inhalation

Respiratory sensitization, Category 1

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Danger
Hazard statement(s)	H317 May cause an allergic skin reaction H332 Harmful if inhaled H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled
Prevention	P261 Avoid breathing dust/fume/gas/mist/vapours/spray. P272 Contaminated work clothing should not be allowed out of the workplace. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/... P271 Use only outdoors or in a well-ventilated area. P284 [In case of inadequate ventilation] wear respiratory protection.
Response	P302+P352 IF ON SKIN: Wash with plenty of water/... P333+P317 If skin irritation or rash occurs: Get medical help. P321 Specific treatment (see ... on this label). P362+P364 Take off contaminated clothing and wash it before reuse. P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing. P317 Get medical help. P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.
Storage	none
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

no data available

Handling and Storage

Precautions for safe handling

Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

Conditions for safe storage, including any incompatibilities

Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

See More Glucagon Safety Data Sheet 

Seller Information

Business Type:
Trader

Main Products:
Semaglutide

Location:
Licheng District, Jinan City, Shandong Province

Payment Terms:
100% TT in advance

Average lead Time:
14

Total Annual Revenue:
$5 million-$10 million

Total Employees:
5-10

Year of Establishment:
2026

Certifications:
Retatrutide coa

Hello and welcome to learn about Kangshengda Biotechnology! We are a specialized enterprise dedicated to the R&D and production of peptide products. Leveraging high-quality peptide preparations, our core strength lies in supporting customers to achieve long-term weight management and all-round health regulation.
Boasting extensive mature export experience, our products are sold to Europe, the United States and numerous other countries and regions worldwide. Supported by consistent, reliable product quality, efficient on-time delivery and a comprehensive professional after-sales service system, we have built long-term, solid strategic partnerships with overseas distributors.
We are committed to delivering one-stop customized premium peptide solutions for all clients, and seek long-term development and win-win cooperation alongside domestic and global partners!
KSD
">KSD

Inquiry History

4 Inquiries

Country	Product	Purchase Quantity	Date Posted
Belgium	Glucagon 16941-32-5 Pharmaceutical grade	10 PCS	Jan 8, 2026
Belgium	Glucagon (1-29)	5 MG	Jan 9, 2026
Netherlands	glucagon	1000 KG	Feb 15, 2024
Bulgaria	Glucagon, not retatrutide, just glucagon	1 G	May 10, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Glucagon Acetate 98% white powder cas 16941-32-5	Cosmetics Grade/95	$100/MT FOB	Chengdu Jinglin Biotechnology Co., Ltd.	Inquiry
Glucagon Hydrochloride	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry
Glucagon 16941-32-5	Reagent Grade/98	$900-1000/G FOB	cellmano peptide	Inquiry
Glucagon Acetate 98% white powder cas 16941-32-5/ Youngshe	Chemical Grade/98	$20-25/UNIT FOB	Youngshe	Inquiry
Glucagon	Pharmaceutical Grade/		zpcChina	Inquiry