Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > Glucagon for Sale > GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery
GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery buy - large image1
GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery buy - image1
GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery buy - image2
GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery buy - image3
GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery buy - image4
GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery buy - image5
GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery buy - image6

GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery

4 Inquiries

Unit Price:

$31.5/UNIT FOB

Get Latest Price
CAS No.:

16941-32-5

Grade:

Pharmaceutical Grade

Content:

99%

Port:

China

Brand:

KZY

Packaging:

2mg/vial

Price valid (until):

2026-09-19

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,Samaglutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    WA:+44 7575 412768

    Items Specifications
    name GND2
    purity >99%
    appearance powder


     Company Detail  


    KZY Peptide Co., Ltd. is a global manufacturer and supplier of peptides and pharmaceutical raw materials in the chemical industry.

    The main products are peptide products and pharmaceutical raw materials. We have strong R&D capabilities, superb synthesis technology, and advanced quality control methods. Effectively promote joint ventures and cooperation with major enterprises and manufacturers, and servethe society and users with the concept of industrial development.We always adhere to market demand-oriented, and continuously synthesize new high-tech chemical products and pharmaceutical intermediates.

    l am very confident in the quality of our products and many foreign customers will give high praise when they receive our goods. Our products are of excellent quality, andwe firmly guarantee that your goods will be delivered to your door. Many foreign customers will give high praise when they receive our goods.

    Our products are of excellent quality and we firmly guarantee that your goods will be delivered to you door to door

    Shop GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery-Detailed Image 1
    Shop GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery-Detailed Image 2
    Shop GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery-Detailed Image 3

     GND2 is a synthetic bioactive peptide. It is supplied as high-purity lyophilized powder with purity ≥99% tested by HPLC. This product is limited to laboratory in-vitro research, mainly applied in cell regulation, biochemical analysis and related biochemical experiments for research institutions and biotechnology laboratories.


    Why choose us?


       1. Stable activity and reliable performance
         Adopting mature synthesis and purification techniques, GND2 maintains stable biological activity. Strict impurity removal effectively avoids experimental data deviation, fully meeting high-standard testing requirements of academic laboratories and biotech research projects.
         2. Standard specification for daily experiments
         The 2mg standard specification matches most conventional laboratory tests and biochemical analysis. Each vial adopts vacuum lyophilization and light-proof sealed packaging, effectively preventing peptide oxidation and activity attenuation during transportation and daily storage.
         3. Strict batch-to-batch quality consistency
         All finished products undergo HPLC purity detection, molecular identity verification and moisture content testing before delivery. Unified production and inspection standards ensure stable and consistent quality among different batches.
          4. Standard global logistics and safe transportation
          We cooperate with experienced international logistics providers. Professional protective packaging is adopted for delivery, full tracking service is provided, and all transportation procedures comply with international import and export regulatory standards.
          5. Adequate inventory and efficient delivery support
         We keep sufficient spot inventory of GND2. Once payment is confirmed, we will finish sorting and delivery arrangement quickly to shorten the waiting time for laboratory research materials.
         6. Professional technical consultation and after-sales service
         Our professional team provides targeted guidance on reconstitution methods, storage rules and experimental application scenarios during working hours. All customer inquiries will be replied within 8 working hours.
         7. Flexible long-term cooperation and preferential policies
         For clients with long-term cooperation needs and bulk orders, we offer stable discounted prices and customized packaging solutions to reduce overall procurement costs of experimental supplies.

    Shop GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery-Detailed Image 4
    Shop GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery-Detailed Image 5
    Shop GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery-Detailed Image 6


     Shipping&Packaging  


    We offer multiple shipping solutions including dedicated line logistics, DHL, FedEx, UPS and EMS to ensure reliable and fast delivery. This guarantees stable tracking, on-time arrival, and minimal transit delays for your orders.

    Shop GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery-Detailed Image 7
    Shop GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery-Detailed Image 8
    Shop GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery-Detailed Image 9


     FAQ 


    Q1: What's your MOQ?

    A:Except for customized products, the MOQ for most items is one box.


    Q2: How about delivery leadtime?

    A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)


    Q3: Is there a discount?

    A:Different quantity has different discount.


    Q4: How to start orders or make payments?

    A:Payment by Wise, USDT, USDC, Bitcoin or Bank transfer.


    Q5: How do you treat quality complaint?

    A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.


    Q6:Do you test all your goods before delivery?

    A:Yes, we have 100% test before delivery,International Authorized Third-Party Test for the products if you need are highly welcomed.

    Shop GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery-Detailed Image 10
    Shop GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery-Detailed Image 11
    Shop GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery-Detailed Image 12
    ECHEMI Editorial Reference
    White or almost white powderProduced by the α cells of the islands of Langerhans and also by the gastric mucosa. It is opposite in effect to insulin. It appears to be a straight-chain polypeptide with a molecular weight of approximately 3500. Small amounts have been detected in commproduced by recombinant DNA technology ismarketed by Novo Nordisk (glucagon [recombinant] hydrochloride,GlucaGen HypoKit, GlucaGen Diagnostic Kit)and by Eli Lilly (glucagon [recombinant] Emergency Kit). The hypergly
    Research & Reference Note

    GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    Glucagon

    Other Name:

    GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN

    CAS No.:

    16941-32-5

    Molecular Formula:

    C153H225N43O49S

    InChIKeys:

    MASNOZXLGMXCHN-ZLPAWPGGSA-N

    Molecular Weight:

    3482.75

    Exact Mass:

    3480.615723

    EC Number:

    232-708-2

    HScode:

    2937190000

    Categories:

    Polypeptide

    Characteristics
    PSA:

    1564.04000

    XLogP3:

    -6.01

    Appearance:

    powder

    Density:

    1.53±0.1 g/cm3(Predicted)

    Refractive Index:

    1.682

    Water Solubility:

    Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.

    Storage Conditions:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Skin sensitization, Category 1

    Acute toxicity - Category 4, Inhalation

    Respiratory sensitization, Category 1

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Danger

    Hazard statement(s)

    H317 May cause an allergic skin reaction

    H332 Harmful if inhaled

    H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled

    Precautionary statement(s)
    Prevention

    P261 Avoid breathing dust/fume/gas/mist/vapours/spray.

    P272 Contaminated work clothing should not be allowed out of the workplace.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    P271 Use only outdoors or in a well-ventilated area.

    P284 [In case of inadequate ventilation] wear respiratory protection.

    Response

    P302+P352 IF ON SKIN: Wash with plenty of water/...

    P333+P317 If skin irritation or rash occurs: Get medical help.

    P321 Specific treatment (see ... on this label).

    P362+P364 Take off contaminated clothing and wash it before reuse.

    P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing.

    P317 Get medical help.

    P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.

    Storage

    none

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,Samaglutide

    Location:

    Room 205, Sanyuanli Avenue, Baiyun District, Guangzhou City

    Payment Terms:

    TT against copy of documents,100% TT in advance

    Average lead Time:

    1

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    101-200

    Year of Establishment:

    2026

  • Inquiry History
    4 Inquiries
    Country Product Purchase Quantity Date Posted
    Belgium

    Glucagon 16941-32-5 Pharmaceutical grade

    10 PCS Jan 8, 2026
    Belgium

    Glucagon (1-29)

    5 MG Jan 9, 2026
    Netherlands

    glucagon

    1000 KG Feb 15, 2024
    Bulgaria

    Glucagon, not retatrutide, just glucagon

    1 G May 10, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.