Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > Glucagon for Sale > GND2 Acetate Lyophilized Powder | LHRH Releasing Hormone Acetate For Lab Only Study
GND2 Acetate Lyophilized Powder | LHRH Releasing Hormone Acetate For Lab Only Study buy - large image1
GND2 Acetate Lyophilized Powder | LHRH Releasing Hormone Acetate For Lab Only Study buy - image1
GND2 Acetate Lyophilized Powder | LHRH Releasing Hormone Acetate For Lab Only Study buy - image2
GND2 Acetate Lyophilized Powder | LHRH Releasing Hormone Acetate For Lab Only Study buy - image3
GND2 Acetate Lyophilized Powder | LHRH Releasing Hormone Acetate For Lab Only Study buy - image4
GND2 Acetate Lyophilized Powder | LHRH Releasing Hormone Acetate For Lab Only Study buy - image5
GND2 Acetate Lyophilized Powder | LHRH Releasing Hormone Acetate For Lab Only Study buy - image6

GND2 Acetate Lyophilized Powder | LHRH Releasing Hormone Acetate For Lab Only Study

4 Inquiries

Unit Price:

$31-35/UNIT EXW

Get Latest Price
CAS No.:

16941-32-5

Grade:

Pharmaceutical Grade

Content:

99%

Port:

ShenZhen

Brand:

XiWu

Packaging:

Foam+Carton

Price valid (until):

2026-09-21

Company Type:
Trader
Location:
China
Qualification:
Main Products:

GLP-1,Retatrutide,Selank,Tirzepatide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    For more information, please contact me.

    +852 9475 8539

    GND2  / GnRH / LHRH) is a synthetic 10‑amino‑acid hypothalamic‑origin peptide, exclusively supplied for pre‑clinical laboratory basic research. It acts as gonadotropin‑releasing hormone receptor ligand, used for GNRHR receptor‑binding assay and endocrine‑related signal‑transduction mechanism exploration. It is applied in cell and rodent animal models for reproductive‑endocrine pathway study, ligand‑receptor interaction and downstream hormone‑release related experimental research. Independently packed in sterile vacuum lyophilized vials, suitable for in‑vitro receptor assays and animal‑model experiments.

    Shop GND2 Acetate Lyophilized Powder | LHRH Releasing Hormone Acetate For Lab Only Study-Detailed Image 1

    Shop AHK-Cu Copper Tripeptide-3 Hair Follicle Regeneration Research Lyophilized Peptide-Detailed Image 1

    After professional freeze-drying treatment, the powder maintains complete molecular activity. It features excellent solubility, can dissolve rapidly and evenly in sterile solvent without producing turbid precipitate or insoluble residues. Strict purification and filtering processes are adopted in the whole production procedure, meeting pharmaceutical-grade production standards, which effectively guarantees stable product efficacy and safety for subsequent preparation and use.

    Shop GND2 Acetate Lyophilized Powder | LHRH Releasing Hormone Acetate For Lab Only Study-Detailed Image 3

    Shop AHK-Cu Copper Tripeptide-3 Hair Follicle Regeneration Research Lyophilized Peptide-Detailed Image 2

    These lyophilized peptide vials adopt standard medical transparent glass bottle design, with smooth, thickened glass walls that deliver excellent light transmission and air tightness. The bottle body is slender and neat, with uniform thickness, sturdy and shatter-resistant for daily transport and storage.
    We offer multiple color options for aluminum plastic caps: yellow, blue, purple, red, white, gold and other lids for your selection. Each cap is tightly crimped with matched butyl rubber stoppers inside, effectively isolating moisture, oxygen and external pollutants to lock the purity and activity of internal white lyophilized powder.
    Empty vials can be customized with printed labels, clearly marking product name, specification and batch information. For bulk storage, we supply matched transparent plastic trays with separate slots to fix each vial firmly, avoiding scratches, collision and breakage during stacking and delivery. Both single loose bottles and tray-packed sets are available to fit sample test and mass wholesale demands.

    Shop AHK-Cu Copper Tripeptide-3 Hair Follicle Regeneration Research Lyophilized Peptide-Detailed Image 3

    Shop GND2 Acetate Lyophilized Powder | LHRH Releasing Hormone Acetate For Lab Only Study-Detailed Image 6

    Core Research Functions
    1. 1.GnRH receptor ligand‑receptor binding & affinity evaluation research
    2. 2.Reproductive‑endocrine related signal‑transduction pathway exploration
    3. 3.Structure‑activity comparative study of LHRH/GnRH peptide analogues
    4. 4.In‑vitro & in‑vivo endocrine‑modulation model experiments
    1. Shop AHK-Cu Copper Tripeptide-3 Hair Follicle Regeneration Research Lyophilized Peptide-Detailed Image 5
    2. Shop AHK-Cu Copper Tripeptide-3 Hair Follicle Regeneration Research Lyophilized Peptide-Detailed Image 6

    3. Our production base is equipped with a standard 100,000-class dust-free purification workshop, fully complying with international pharmaceutical production hygiene standards. The whole production process adopts fully automated stainless steel reaction equipment, independent R&D laboratories and precision testing instruments to strictly control raw material purification, freeze-drying, filling and packaging links.
      All production staff wear full set of dust-proof protective clothing, masks and hair caps to avoid external pollution during operation. We have complete supporting facilities including raw material storage area, finished product assembly line, central cooling system and professional quality inspection room. Every batch of products will go through multi-index sampling inspection before leaving the factory to guarantee stable purity and consistent quality.
       independent large-scale production capacity to meet small batch sample orders and bulk mass production demands for global customers. Over 10 years of factory export experience enables us to provide one-stop service from formula customization, bottle packaging design to international logistics delivery.


    4. Shop AHK-Cu Copper Tripeptide-3 Hair Follicle Regeneration Research Lyophilized Peptide-Detailed Image 7
    5. Multi-layer Protective Packaging

      1. 1.Inner Sealed Package
        We use thickened aluminum foil vacuum bags for separate packing, which can block moisture, light and air, fully preserve product activity and avoid deterioration during transit. Vial products are fixed by special transparent plastic trays to prevent collision and breakage.

      2. 2.Middle Buffer Layer
        All goods are wrapped with bubble film and pearl cotton to buffer extrusion and bump during air and sea transportation, effectively avoiding glass bottle cracking.

      3. 3.Outer Shipping Container
        Two options: thick 5-layer corrugated cartons for small sample orders, and heavy-duty fiber drums for bulk orders. Fiber drums have stronger load-bearing capacity and are not easy to deform after stacking, suitable for long-term warehouse storage.

      4. 4.Standard Constant-temperature Warehouse
        We own a large constant-temperature warehouse with classified storage racks for raw materials and finished goods. All goods are sorted and counted one by one before shipment to prevent wrong or missing delivery.





    Items Specifications
    Purity ≥99%
    Appearance transparent glass vial
    Shipping method Air freight/DDP


    Global Multi-channel Shipping Solutions
    We support air express, sea freight and door-to-door courier services, covering most countries worldwide:


    1.Commercial Express: DHL / UPS / FedEx / TNT
    Fast lead time, only 3–7 working days to Europe, America, Southeast Asia. Full logistics tracking available online. Ideal for urgent orders and small sample batches. We also provide customs clearance documents to lower customs detention risks.


    2.EMS International Express
    Outstanding customs clearance performance with fewer restrictions. Cost-effective for regular orders, delivery time 7–12 days.


    3.Air Freight Special Line
    Perfect for large bulk shipments, balancing fast transit and competitive price. Door-to-door tax-included clearance service is optional for worry-free delivery.

    Shop AHK-Cu Copper Tripeptide-3 Hair Follicle Regeneration Research Lyophilized Peptide-Detailed Image 8

    Q1: What's your MOQ?

    A:For the regular produced products, our MOQ is 1box, for other customized products, our MOQ starts from 10boxes to 50boxes.

    Q2: How to confirm the product quality before placing the order?

    A:We have inspection report.

    Q3: Which kind of payment terms do you accept??

    A: Paypal,T/T ,BTC,USDT etc.

    Q4. Are there opportunities for partnerships or collaborations with your company?

    We are open to exploring partnerships and collaborations with you. Please contact our business development team to discuss potential opportunities.



    ECHEMI Editorial Reference
    White or almost white powderProduced by the α cells of the islands of Langerhans and also by the gastric mucosa. It is opposite in effect to insulin. It appears to be a straight-chain polypeptide with a molecular weight of approximately 3500. Small amounts have been detected in commproduced by recombinant DNA technology ismarketed by Novo Nordisk (glucagon [recombinant] hydrochloride,GlucaGen HypoKit, GlucaGen Diagnostic Kit)and by Eli Lilly (glucagon [recombinant] Emergency Kit). The hypergly
    Research & Reference Note

    GND2 Acetate Lyophilized Powder | LHRH Releasing Hormone Acetate For Lab Only Study is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    Glucagon

    Other Name:

    GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN

    CAS No.:

    16941-32-5

    Molecular Formula:

    C153H225N43O49S

    InChIKeys:

    MASNOZXLGMXCHN-ZLPAWPGGSA-N

    Molecular Weight:

    3482.75

    Exact Mass:

    3480.615723

    EC Number:

    232-708-2

    HScode:

    2937190000

    Categories:

    Other Chemical Drugs

    Characteristics
    PSA:

    1564.04000

    XLogP3:

    -6.01

    Appearance:

    powder

    Density:

    1.53±0.1 g/cm3(Predicted)

    Refractive Index:

    1.682

    Water Solubility:

    Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.

    Storage Conditions:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Skin sensitization, Category 1

    Acute toxicity - Category 4, Inhalation

    Respiratory sensitization, Category 1

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Danger

    Hazard statement(s)

    H317 May cause an allergic skin reaction

    H332 Harmful if inhaled

    H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled

    Precautionary statement(s)
    Prevention

    P261 Avoid breathing dust/fume/gas/mist/vapours/spray.

    P272 Contaminated work clothing should not be allowed out of the workplace.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    P271 Use only outdoors or in a well-ventilated area.

    P284 [In case of inadequate ventilation] wear respiratory protection.

    Response

    P302+P352 IF ON SKIN: Wash with plenty of water/...

    P333+P317 If skin irritation or rash occurs: Get medical help.

    P321 Specific treatment (see ... on this label).

    P362+P364 Take off contaminated clothing and wash it before reuse.

    P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing.

    P317 Get medical help.

    P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.

    Storage

    none

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    GLP-1,Retatrutide,Selank,Tirzepatide

    Location:

    Room 307, No. 3, Building 7, Area 4, Pingchou, Jiangdong Street, Yiwu City, Jinhua City, Zhejiang Province

    Payment Terms:

    TT against copy of documents,100% TT in advance

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    11-50

    Year of Establishment:

    2026

  • Inquiry History
    4 Inquiries
    Country Product Purchase Quantity Date Posted
    Belgium

    Glucagon 16941-32-5 Pharmaceutical grade

    10 PCS Jan 8, 2026
    Belgium

    Glucagon (1-29)

    5 MG Jan 9, 2026
    Netherlands

    glucagon

    1000 KG Feb 15, 2024
    Bulgaria

    Glucagon, not retatrutide, just glucagon

    1 G May 10, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.