Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > Myostatin(GDF-8), Human, recombinant for Sale > Hot Selling FOXO4 raw powder Peptide for Cosmetic with good price
Hot Selling FOXO4 raw powder Peptide for Cosmetic with good price buy - large image1
Hot Selling FOXO4 raw powder Peptide for Cosmetic with good price buy - image1
Hot Selling FOXO4 raw powder Peptide for Cosmetic with good price buy - image2
Hot Selling FOXO4 raw powder Peptide for Cosmetic with good price buy - image3
Hot Selling FOXO4 raw powder Peptide for Cosmetic with good price buy - image4
Hot Selling FOXO4 raw powder Peptide for Cosmetic with good price buy - image5
Hot Selling FOXO4 raw powder Peptide for Cosmetic with good price buy - image6

Hot Selling FOXO4 raw powder Peptide for Cosmetic with good price

TDS 2 Inquiries

Unit Price:

$28-33/UNIT FOB

Get Latest Price
CAS No.:

271597-12-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Shenzhen

Brand:

PGpeptides

Packaging:

10 vials/kit

Price valid (until):

2026-09-24

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Contact Information   


    Name:Zara Wang

    Whatsapp:+852 5534 6904

    Please add me for our latest price list and COA


      Product Detail  


    Name: FOXO4
    CAS#: N/A
    Molecular Formula: N/A Recombinant Protein
    Molecular Weight: ≈52 kDa
    Sequence: FOXO4-DRI Synthetic Peptide
    Appearance: White Powder
    Purity (HPLC): ≥99.0%
    Single Impurity (HPLC): ≤1.0%
    Moisture Content (Karl Fischer): ≤10.0%
    Peptide Content: ≥80.0%
    Storage: Store at -20℃ degrees Celsius in a dry and cool place.
    Storage Condition: Store at -20°C
    Solubility in DMSO: 3mg/mL

    What is FOXO4 used for?

    FOXO4 is a high-specificity bioactive peptide targeting senescent cell regulation. It modulates aging-related cellular signaling and improves endogenous cell renewal. It is widely applied in anti-aging research, cellular repair studies and daily physiological anti-aging conditioning.

    What does FOXO4 do to your body?

    FOXO4 selectively regulates aging cell activity and promotes the clearance of stagnant senescent cells. It protects normal cell vitality, optimizes cellular microenvironment, relieves cumulative oxidative aging, and stabilizes bodily physiological functions.

    What effect can you get with FOXO4?

    Long-term standardized use effectively delays cellular aging and improves age-related physical sub-health. It enhances endogenous cell regeneration capacity, restores physical vitality, and delivers mild, safe and durable anti-aging conditioning effects.

    Product Description :

    FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

    Function & Application:

    FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

    Appearance: Powder

    Purity: >98% (or refer to the Certificate of Analysis)

    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Solubility: To be determined

    Shelf Life: >2 years if stored properly

    Drug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).


    Items Specifications
    Product Name FOXO4
    CAS No.  271597-12-7
    Package 10 vials/kit
    Shop Hot Sale Vitamin B12 Additives Pharmaceutical Grade Raw Powder Folic Acid-Detailed Image 1
    Shop Hot Sale Vitamin B12 Additives Pharmaceutical Grade Raw Powder Folic Acid-Detailed Image 2
    Shop Hot Sale Vitamin B12 Additives Pharmaceutical Grade Raw Powder Folic Acid-Detailed Image 3
    Shop Hot Sale Vitamin B12 Additives Pharmaceutical Grade Raw Powder Folic Acid-Detailed Image 4
    Shop Hot Sale Vitamin B12 Additives Pharmaceutical Grade Raw Powder Folic Acid-Detailed Image 5
    Shop Hot Sale Vitamin B12 Additives Pharmaceutical Grade Raw Powder Folic Acid-Detailed Image 6
    Shop Hot Sale Vitamin B12 Additives Pharmaceutical Grade Raw Powder Folic Acid-Detailed Image 7
    Shop Hot Sale Vitamin B12 Additives Pharmaceutical Grade Raw Powder Folic Acid-Detailed Image 8
    Shop Hot Sale Vitamin B12 Additives Pharmaceutical Grade Raw Powder Folic Acid-Detailed Image 9
    Shop Hot Sale Vitamin B12 Additives Pharmaceutical Grade Raw Powder Folic Acid-Detailed Image 10
    Shop Hot Sale Vitamin B12 Additives Pharmaceutical Grade Raw Powder Folic Acid-Detailed Image 11


      Company Profile


    Shop Hot Sale Vitamin B12 Additives Pharmaceutical Grade Raw Powder Folic Acid-Detailed Image 12
    ECHEMI Editorial Reference
    Myostatin is a kind of TGF-β family discovered as a factor involved in the modulation of the number of muscles. It inhibits the growth of skeletal muscles, and in knockout mice, an increase in skeletal muscles and a decrease in body fat mass have been reported. Myostatin activity is inhibited by follistatin, an activin-binding protein and myostatin propeptide. Growth Differentiation Factor 8 (GDF-8), also known as myostatin, is a member of the TGF-beta superfamily expressed specifically in developing and adult skeletal muscle. GDF-8 cDNA encodes a 376 amino acid (aa) prepropeptide with a 24 aa residue signal peptide, a 223 aa residue amino-terminal propeptide, and a 109 aa residue carboxy-terminal mature protein. Mature GDF-8 contains the canonical 7-cysteine motif common to other TGF-beta superfamily members.
    Research & Reference Note

    Hot Selling FOXO4 raw powder Peptide for Cosmetic with good price is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    Myostatin(GDF-8), Human, recombinant

    Other Name:

    Myostatin(GDF-8), Human, recombinant;Myostatin (GDF-8) 1mg

    CAS No.:

    271597-12-7

    Molecular Weight:

    0

    Categories:

    Polypeptide

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides

    Location:

    Y17, Room 310, East Third Floor, No. 64 and 66 Jianzhong Road, Tianhe District, Guangzhou City

    Payment Terms:

    TT against copy of documents,100% TT in advance

    Average lead Time:

    1

    Total Employees:

    11-50

    Year of Establishment:

    2026

    Founded in 2024, PGpeptides is a specialized supplier of high-purity
    research peptides serving the global scientific community. With deep
    industry expertise, we deliver consistent product quality, competitive
    pricing, and flexible service tailored to research institutions, laboratories,
    and distributors worldwide.
    Our operations span North America, Europe, Asia, Australia, and the
    Middle East, backed by a mature international trade infrastructure and a
    reliable global fulfillment network. We have earned strong recognition 
    and trust across the markets we serve.
  • Inquiry History
    2 Inquiries
    Country Product Purchase Quantity Date Posted
    Lithuania

    gdf8

    10 G Feb 28, 2026
    United States

    Gdf-8

    10 MG Feb 22, 2025
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.