Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > Research Grade LL37 Peptide | Antimicrobial Host Defense Peptide for Cell & Animal Experiment
Research Grade LL37 Peptide | Antimicrobial Host Defense Peptide for Cell & Animal Experiment buy - large image1
Research Grade LL37 Peptide | Antimicrobial Host Defense Peptide for Cell & Animal Experiment buy - image1
Research Grade LL37 Peptide | Antimicrobial Host Defense Peptide for Cell & Animal Experiment buy - image2
Research Grade LL37 Peptide | Antimicrobial Host Defense Peptide for Cell & Animal Experiment buy - image3
Research Grade LL37 Peptide | Antimicrobial Host Defense Peptide for Cell & Animal Experiment buy - image4
Research Grade LL37 Peptide | Antimicrobial Host Defense Peptide for Cell & Animal Experiment buy - image5
Research Grade LL37 Peptide | Antimicrobial Host Defense Peptide for Cell & Animal Experiment buy - image6

Research Grade LL37 Peptide | Antimicrobial Host Defense Peptide for Cell & Animal Experiment

3 Inquiries

Unit Price:

$54-61/UNIT EXW

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

ShenZhen

Brand:

XiWu

Packaging:

Foam+Carton

Price valid (until):

2026-09-25

Company Type:
Trader
Location:
China
Qualification:
Main Products:

GLP-1,Retatrutide,Selank,Tirzepatide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    For more information, please contact me.

    +852 9475 8539

    LL-37 is a synthetic human-derived 37-amino-acid cationic antimicrobial peptide, exclusively supplied for preclinical laboratory basic research. It participates in innate immune regulation, microbial membrane disturbance and inflammatory signal transduction. It is widely used to investigate antimicrobial activity, immune cell chemotaxis and tissue repair mechanisms via cell experiments and rodent animal models. Independently packed in sterile vacuum lyophilized vials with low endotoxin standards, suitable for cell culture and animal administration tests.

    Shop Research Grade LL37 Peptide | Antimicrobial Host Defense Peptide for Cell & Animal Experiment-Detailed Image 1

    Shop AHK-Cu Copper Tripeptide-3 Hair Follicle Regeneration Research Lyophilized Peptide-Detailed Image 1

    After professional freeze-drying treatment, the powder maintains complete molecular activity. It features excellent solubility, can dissolve rapidly and evenly in sterile solvent without producing turbid precipitate or insoluble residues. Strict purification and filtering processes are adopted in the whole production procedure, meeting pharmaceutical-grade production standards, which effectively guarantees stable product efficacy and safety for subsequent preparation and use.

    Shop Research Grade LL37 Peptide | Antimicrobial Host Defense Peptide for Cell & Animal Experiment-Detailed Image 3

    Shop AHK-Cu Copper Tripeptide-3 Hair Follicle Regeneration Research Lyophilized Peptide-Detailed Image 2

    These lyophilized peptide vials adopt standard medical transparent glass bottle design, with smooth, thickened glass walls that deliver excellent light transmission and air tightness. The bottle body is slender and neat, with uniform thickness, sturdy and shatter-resistant for daily transport and storage.
    We offer multiple color options for aluminum plastic caps: yellow, blue, purple, red, white, gold and other lids for your selection. Each cap is tightly crimped with matched butyl rubber stoppers inside, effectively isolating moisture, oxygen and external pollutants to lock the purity and activity of internal white lyophilized powder.
    Empty vials can be customized with printed labels, clearly marking product name, specification and batch information. For bulk storage, we supply matched transparent plastic trays with separate slots to fix each vial firmly, avoiding scratches, collision and breakage during stacking and delivery. Both single loose bottles and tray-packed sets are available to fit sample test and mass wholesale demands.

    Shop AHK-Cu Copper Tripeptide-3 Hair Follicle Regeneration Research Lyophilized Peptide-Detailed Image 3

    Shop Research Grade LL37 Peptide | Antimicrobial Host Defense Peptide for Cell & Animal Experiment-Detailed Image 6


    Mechanism:

    1. 1.Basic research on host innate immunity and antibacterial mechanism
      2.Exploration of FPR2 receptor-mediated inflammatory signaling pathways
      3.Comparative study of cationic polypeptide membrane interaction characteristics
      4.Tissue injury repair and angiogenesis related preclinical experiments

    2. Important Notice: For laboratory research only. cosmetic production or clinical therapeutic use. Not authorized for human or veterinary treatment.
    3. Shop AHK-Cu Copper Tripeptide-3 Hair Follicle Regeneration Research Lyophilized Peptide-Detailed Image 5
    4. Shop AHK-Cu Copper Tripeptide-3 Hair Follicle Regeneration Research Lyophilized Peptide-Detailed Image 6

    5. Our production base is equipped with a standard 100,000-class dust-free purification workshop, fully complying with international pharmaceutical production hygiene standards. The whole production process adopts fully automated stainless steel reaction equipment, independent R&D laboratories and precision testing instruments to strictly control raw material purification, freeze-drying, filling and packaging links.
      All production staff wear full set of dust-proof protective clothing, masks and hair caps to avoid external pollution during operation. We have complete supporting facilities including raw material storage area, finished product assembly line, central cooling system and professional quality inspection room. Every batch of products will go through multi-index sampling inspection before leaving the factory to guarantee stable purity and consistent quality.
       independent large-scale production capacity to meet small batch sample orders and bulk mass production demands for global customers. Over 10 years of factory export experience enables us to provide one-stop service from formula customization, bottle packaging design to international logistics delivery.


    6. Shop AHK-Cu Copper Tripeptide-3 Hair Follicle Regeneration Research Lyophilized Peptide-Detailed Image 7
    7. Multi-layer Protective Packaging

      1. 1.Inner Sealed Package
        We use thickened aluminum foil vacuum bags for separate packing, which can block moisture, light and air, fully preserve product activity and avoid deterioration during transit. Vial products are fixed by special transparent plastic trays to prevent collision and breakage.

      2. 2.Middle Buffer Layer
        All goods are wrapped with bubble film and pearl cotton to buffer extrusion and bump during air and sea transportation, effectively avoiding glass bottle cracking.

      3. 3.Outer Shipping Container
        Two options: thick 5-layer corrugated cartons for small sample orders, and heavy-duty fiber drums for bulk orders. Fiber drums have stronger load-bearing capacity and are not easy to deform after stacking, suitable for long-term warehouse storage.

      4. 4.Standard Constant-temperature Warehouse
        We own a large constant-temperature warehouse with classified storage racks for raw materials and finished goods. All goods are sorted and counted one by one before shipment to prevent wrong or missing delivery.





    Items Specifications
    Purity ≥99%
    Appearance transparent glass vial
    Shipping method Air freight/DDP


    Global Multi-channel Shipping Solutions
    We support air express, sea freight and door-to-door courier services, covering most countries worldwide:


    1.Commercial Express: DHL / UPS / FedEx / TNT
    Fast lead time, only 3–7 working days to Europe, America, Southeast Asia. Full logistics tracking available online. Ideal for urgent orders and small sample batches. We also provide customs clearance documents to lower customs detention risks.


    2.EMS International Express
    Outstanding customs clearance performance with fewer restrictions. Cost-effective for regular orders, delivery time 7–12 days.


    3.Air Freight Special Line
    Perfect for large bulk shipments, balancing fast transit and competitive price. Door-to-door tax-included clearance service is optional for worry-free delivery.

    Shop AHK-Cu Copper Tripeptide-3 Hair Follicle Regeneration Research Lyophilized Peptide-Detailed Image 8

    Q1: What's your MOQ?

    A:For the regular produced products, our MOQ is 1box, for other customized products, our MOQ starts from 10boxes to 50boxes.

    Q2: How to confirm the product quality before placing the order?

    A:We have inspection report.

    Q3: Which kind of payment terms do you accept??

    A: Paypal,T/T ,BTC,USDT etc.

    Q4. Are there opportunities for partnerships or collaborations with your company?

    We are open to exploring partnerships and collaborations with you. Please contact our business development team to discuss potential opportunities.



    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    Research Grade LL37 Peptide | Antimicrobial Host Defense Peptide for Cell & Animal Experiment is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    GLP-1,Retatrutide,Selank,Tirzepatide

    Location:

    Room 307, No. 3, Building 7, Area 4, Pingchou, Jiangdong Street, Yiwu City, Jinhua City, Zhejiang Province

    Payment Terms:

    TT against copy of documents,100% TT in advance

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    11-50

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.