Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Diagnostic Agents > LL-37 for Sale > NP810------+--+High purity, large quantity, discounted price. Direct delivery from the manufacturer.
NP810------+--+High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - large image1
NP810------+--+High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - image1
NP810------+--+High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - image2
NP810------+--+High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - image3
NP810------+--+High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - image4
NP810------+--+High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - image5
NP810------+--+High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - image6

NP810------+--+High purity, large quantity, discounted price. Direct delivery from the manufacturer.

KOSHER ISO COA TDS 3 Inquiries

Unit Price:

$1-1.3/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.9%

Port:

SHENZHEN

Brand:

CUSTOM-MADE

Packaging:

10 pieces per box

Price valid (until):

2027-10-28

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

polypeptide,GHK-CU,NAD+,Tirzepatide,GLutathione

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    WHATSAPP+85265540844


    Company Profile 



    Hong Kong Biopetide Research Limited is a high-tech enterprise specializing in the research, development, production, and sales of peptide products. The company boasts advanced laboratories and a rigorous quality control system, with its products having obtained multiple international certifications, ensuring safety and efficacy.
    Its customers are spread across Europe, the United States, Southeast Asia, the Middle East, and other regions.
    Biotechnology Co., Ltd. is a high-tech enterprise specializing in the research, development, production, and sales of peptide products. With advanced laboratories and a rigorous quality control system, our products have obtained international certification, ensuring safety and efficacy.
    As a global trading company, we provide customized solutions to customers across Europe, the United States, Southeast Asia, the Middle East, and many other regions. Upholding the philosophy of "technology leading health," we are committed to innovation, striving to deliver high-quality health products to consumers worldwide. Our business principles focus on establishing a strong domestic market presence, increasing R&D investment, manufacturing premium products, and leveraging technology to promote environmental protection and sustainable development. At the same time, we actively expand into international markets, serve society with sincerity, and aim to become a modern, eco-friendly, and technologically advanced enterprise that meets global standards. Contact Us

    Our products have been exported to 130 countries and regions. We are committed to building stable, strategic, and long-term partnerships with suppliers and customers both domestically and internationally, working together to create a brighter future.

    Product Detail  

    GTT1500 is a high-dose reduced glutathione, a tripeptide of Glu-Cys-Gly. It is the body’s primary endogenous antioxidant and detoxifier. It neutralizes free radicals, protects cells, and delays senescence. It supports liver detoxification, inhibits melanin production for skin whitening, and boosts immunity. For research, cosmetic & health supplement use only. Store at -20°C with cold-chain transport.

       About  US

     

    Q1: Has your product quality been certified by third-party laboratories?


    A: Yes. All our products have undergone rigorous testing by our quality control department, been verified by the quality assurance team, and approved by third-party laboratories in China. By choosing us, you are guaranteed to receive high-quality products.

    Q2: How do we cooperate with you?

    A: You can contact us via the information on our website to initiate cooperation, or reach out directly to our sales team. We will then communicate all specific details with you via email.

    Q3: Do you offer discounts?

    A: Yes. We always offer more favorable prices for large-volume orders.

    Q4: What payment options are available?

    A: US customers can pay via Chime and Venmo.  But we mainly recommend: USDT, BTC, MoneyGram, Wise and Alipay.

    Q5: How long does it take for the goods to arrive?

    A: It depends on your location. For small orders, delivery via DHL, UPS, TNT, FedEx or EMS usually takes 5-7 days. For bulk orders, air freight takes 5-8 days, while sea freight takes 20-35 days.

    Q6: Can I get a sample before placing an order?

    A: Yes,
    We can provide samples if necessary.

    Q7: Do you have a return and reshipment policy?

    A: We have comprehensive after-sales service and a reshipment policy for lost packages. We highly value long-term cooperation with our customers. We take great care in product packaging, and our customers can attest to this—even when locating products is difficult, our packaging ensures they are easy to identify. Despite our best efforts, a small number of packages may still be lost. In such cases, we promise to reship the goods free of charge to build a long-term partnership with you.


     

    Hazard Identification

    Classification of the substance or mixture

    no data available

    GHS label elements, including precautionary statements

    Pictogram(s)

    no data available

    Signal word

    no data available

    Hazard statement(s)

    no data available

    Precautionary statement(s)

    Prevention

    no data available

    Response

    no data available

    Storage

    no data available

    Disposal

    no data available

    Other hazards which do not result in classification

    no data available


    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

      Shipping&Packaging  

    We mainly adopt special line logistics and FedEx transportation methods. It can fully guarantee shipping timeliness, fast delivery, stable logistics track, safe and on-time arrival.
    Hazard Identification

    Classification of the substance or mixture

    Not classified.

    GHS label elements, including precautionary statements

    Pictogram(s) No symbol.
    Signal word

    No signal word

    Hazard statement(s)

    none

    Precautionary statement(s)
    Prevention

    none

    Response

    none

    Storage

    none

    Disposal

    none

    Other hazards which do not result in classification

    no data availableShop GTT1500-High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 1 Shop GTT1500-High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 2 Shop GTT1500-High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 3 Shop GTT1500-High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 4 Shop GTT1500-High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 5 Shop RT15-purity, large quantity, discounted price. Direct delivery frHigh purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 6 Shop RT15-purity, large quantity, discounted price. Direct delivery frHigh purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 7 Shop RT15-purity, large quantity, discounted price. Direct delivery frHigh purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 8 Shop RT15-purity, large quantity, discounted price. Direct delivery frHigh purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 9 Shop RT15-purity, large quantity, discounted price. Direct delivery frHigh purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 10 Shop RT15-purity, large quantity, discounted price. Direct delivery frHigh purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 11 Shop RT15-purity, large quantity, discounted price. Direct delivery frHigh purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 12 Shop RT15-purity, large quantity, discounted price. Direct delivery frHigh purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 13 Shop RT15-purity, large quantity, discounted price. Direct delivery frHigh purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 14 Shop 2AD------High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 15 Shop 2AD------High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 16 Shop 2AD------High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 17

    Items Specifications
    Category Peptides
    Purpose Weight Loss
    Purity 99.9%
    Specification numerous species
    Storage Dry Cool Sealed Container
    Origin China
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates
    • NP810------+--+High purity, large quantity, discounted price. Direct delivery from the manufacturer. Certificates 4 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Diagnostic Agents

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    polypeptide,GHK-CU,NAD+,Tirzepatide,GLutathione

    Location:

    Room 5003, 5/F, Lee Yu Centre, 45 Hoi Yuen Road, Kwun Tong, Hong Kong

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.