 Home > Biochemical Engineering > Polypeptide > Teriparatide acetate for Sale > Teriparatide acetate Teriparatide acetate

Teriparatide acetate Teriparatide acetate

14 Inquiries

Unit Price:

$1000-1001/G FOB

Get Latest Price 

CAS No.:

52232-67-4

Port:

qingdao

Packaging:

Price valid (until):

2026-10-12

Contact Supplier

 Chat Now

SHANDONG LOOK CHEMICAL CO.,LTD

Company Type:

Manufactory

Location:

China

Qualification:

Main Products:

Agrochemicals,Daily Chemicals,Catalysts & Chemical Auxiliary Agents,Extract,Inorganic Chemicals,Organic Intermediate

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Detail

PARATHYROIDHORMONEHUMAN:FRAGMENT1-34;PARATHYROIDHORMONE(HUMAN,1-34);PTH(1-34)(HUMAN);PTH(HUMAN,1-34);Teriparatideacetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ChemicalbookASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHEHUMAN

Items	Specifications

ECHEMI Editorial Reference

The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.

Basic Info

Product Name:

Teriparatide acetate

Other Name:

PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

CAS No.:

52232-67-4

Molecular Formula:

C172H278N52O47S2

InChIKeys:

BUUKFBVDKSFMHN-LKMAISLMSA-N

Molecular Weight:

3890.49792

EC Number:

640-978-1

Color/Form:

White to Off-White

HScode:

2937190000

Categories:

Polypeptide

Characteristics

Melting Point:

>205oC (dec.)

Water Solubility:

Soluble to 0.40 mg/ml in water

Critical Temperature & Pressure:

−20°C

See More Teriparatide acetate Properties 

Hazard Identification

Classification of the substance or mixture

Carcinogenicity, Category 2

Reproductive toxicity, Category 2

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Warning
Hazard statement(s)	H351 Suspected of causing cancer H361 Suspected of damaging fertility or the unborn child
Prevention	P203 Obtain, read and follow all safety instructions before use. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
Response	P318 IF exposed or concerned, get medical advice.
Storage	P405 Store locked up.
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

no data available

Handling and Storage

Precautions for safe handling

Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

Conditions for safe storage, including any incompatibilities

Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

See More Teriparatide acetate Safety Data Sheet 

Seller Information

Business Type:
Manufactory

Main Products:
Agrochemicals,Daily Chemicals,Catalysts & Chemical Auxiliary Agents,Extract,Inorganic Chemicals,Organic Intermediate

Location:
hisense intelligence valley,no 2116,of phoenix road

Payment Terms:
TT against copy of documents,D/P,L/C

Average lead Time:
7

Total Annual Revenue:
Less than $1 million

Total Employees:
11-50

Year of Establishment:
2017

SHANDONG LOOK CHEMICAL CO.LTD, a new chemical enterprise in researching, manufacturing and supplying of chemicals located in beautiful “Spring City”-Jinan.Our company mainly working on the researching new-born APIs, intermediate ( especially Carbohydrate derivatives series). Meanwhile, we made huge breakthrough in industries of food, feed additives, cosmetics ,dye and industrial chemicals. Our company enjoyed great reputation both domestic and abroad under the belief of “Integrity management,Quality controlling and Customer orientation”. Web : www.chinalookchemical.com

We had been cooperated with NingXia University and Shandong University on more than ten projects for years and which had been in mass production on the market. We now have more than 80 people in our team and built research center in Jinan and Ningxia. Our manufacturing site allocated in chemical industry parks of Zhangqiu, Heze, Dezhou and Ningxia Fine Chemical Park. We strictly complying with ISO9001 and ISO 2000 standard in manufacturing process, our lab and workshop tightly in accordance with GMP standard.Our products best selling in Europe, South and North America,Asia pacific area and Africa. We sincerely welcome new and regular customers around the world visit us for business negotiation.

Inquiry History

14 Inquiries

Country	Product	Purchase Quantity	Date Posted
United States	Teriparatide	1 KG	May 28, 2026
United States	teriparatide	1 G	Sep 6, 2026
Russia	teriparatide	100 MG	Feb 23, 2026
Kazakstan	Teriparatide	1 KG	Jan 4, 2026
Kazakstan	Teriparatide	5 MG	Jan 1, 2026
Kazakstan	teriparatide	1 KG	Nov 17, 2025
Russia	Teriparatide	1 G	Sep 12, 2026
Russia	Teriparatide	1 G	Sep 12, 2026
United States	Teriparatide kit of 10 2mg vials	1 MT	Sep 7, 2026
Germany	Teriparatide Acetate	5 MG	Jul 5, 2026
United States	Teriparatide	10 MT	May 29, 2026
Bulgaria	teripatatide	1	May 17, 2026
Kazakstan	Teriparatide	5 MG	Jan 2, 2026
United Kingdom	Supply	1	Mar 5, 2024

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Teriparatide high quality white raw powder wholesale factory direct	Pharmaceutical Grade/99		Jinshu Peptide Co.,Ltd	Inquiry
Teriparatide Acetate CAS NO.52232-67-4 ,99294-94-7	Research grade/		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry
Teriparatide 52232-67-4	Reagent Grade/95	$800-900/G FOB	cellmano peptide	Inquiry
Teriparatide Pharmacy Grade	Pharmaceutical Grade/		zpcChina	Inquiry
52232-67-4	/		Guangzhou Yaoguang Technology Co., Ltd.	Inquiry