Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > Teriparatide acetate for Sale > Teriparatide CAS 52232-67-4 99% Purity Peptide Lyophilized Powder Factory Supply
Teriparatide CAS 52232-67-4 99% Purity Peptide Lyophilized Powder Factory Supply buy - large image1
Teriparatide CAS 52232-67-4 99% Purity Peptide Lyophilized Powder Factory Supply buy - image1
Teriparatide CAS 52232-67-4 99% Purity Peptide Lyophilized Powder Factory Supply buy - image2
Teriparatide CAS 52232-67-4 99% Purity Peptide Lyophilized Powder Factory Supply buy - image3
Teriparatide CAS 52232-67-4 99% Purity Peptide Lyophilized Powder Factory Supply buy - image4

Teriparatide CAS 52232-67-4 99% Purity Peptide Lyophilized Powder Factory Supply

TDS 14 Inquiries

Unit Price:

$170/UNIT FOB

Get Latest Price
CAS No.:

52232-67-4

Grade:

Research Grade

Content:

99%

Port:

HK

Brand:

hnkunyao

Packaging:

10mg/vial

Price valid (until):

2026-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

PEPTIDES

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Contact information  


    Whatsapp:+852 4490 2016
    WeChat:+86 188 300 14627
    Mailbox: kyemi01che@163.com



    Our service  


    1. We supply peptides, APIs and intermediates to meet your needs;
    2. We will reply to your inquiry within 24 hours;
    3. Strictly select raw materials. Our Q&A team will strictly check the quality of each product before delivery;
    4. Reasonable and competitive price and fast delivery time;
    After delivery, we will help you track it every two days until you receive the product. When you receive the goods, if you have any questions, please contact us and we will provide you with a solution;
    6. 100% safe delivery and guaranteed delivery.


      Company profile  


    Focus on the research and development, production and customized services of high-quality peptides. With excellent technical strength and strict quality control system, the company provides reliable peptide products and solutions for scientific research institutions, pharmaceutical enterprises and biotechnology enterprises around the world.
    Strong ability to lay the foundation of quality.
    Advanced technology platform: equipped with internationally advanced peptide synthesis equipment and purification system, adopting cutting-edge technologies such as solid-phase synthesis (SPPS) and liquid-phase synthesis, it can support research and development from mg to kg, and ensure high purity and activity of products.
    Strict quality control: following the ISO 9001 quality management system, each batch of products has undergone multidimensional tests, including high performance liquid chromatography (HPLC) and mass spectrometry (MS), and complete quality inspection reports are provided to ensure the quality traceability of the whole production process.
    Efficient customized service: It has a professional R&D team, which can quickly respond to customers' needs, support complex sequence synthesis, customize modified peptide segments (such as phosphorylation, fluorescence labeling, polyethylene glycol modification, etc.), and provide one-stop service from solution design to delivery.


    Payment


    Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 1 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 2 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 3 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 4 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 5


      FQA  


    Q: How to store it?
    Answer: If it has not been opened, put it in a cool and dry place; If opened, it can be refrigerated to 2-5 degrees.
    Q: How do I order this product?
    A: You can click "Contact Supplier", or send an email to my inbox, send a consultation, leave a message if possible, and we will contact you as soon as possible, and then discuss the details of the order.
    Q: What is the delivery time?
    A: Delivery will be made within 48 hours after receipt of payment. Small orders are delivered by express delivery. The goods will arrive in about 7 to 10 days.
    Q: Is it cash on delivery?
    A: In most cases, we don't support cash on delivery.
    Q: What is the price of the goods?
    A: As we all know, the price of chemicals is not fixed, but fluctuates with the market.
    You need to contact me to get the latest product price, and we guarantee to provide you with the most favorable price.
    Q: About after-sales service?
    A: After purchasing our products, we have a professional technical team and after-sales team to serve you and solve all your future problems.


      Product Detail  







    Tirzepatide (LY3298176) is a dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist that is being developed for the treatment of type 2 diabetes. Tirzepatide (LY3298176) shows significantly better efficacy with regard to glucose control and weight loss than do Dulaglutide. Tirzepatide, also known as LY 3298176, is a dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist. Tirzepatide has a greater affinity to GIP receptors than to GLP-1 receptors, and this dual agonist behavior has been shown to produce greater reductions of hyperglycemia compared to a selective GLP-1 receptor agonist. Signaling studies reported that tirzepatide mimics the actions of natural GIP at the GIP receptor. Tirzepatide was approved for improving blood sugar control in adults with type 2 diabetes, as an addition to diet and exercise.

    Product name Teriparatide 10mg
    CAS NO 52232-67-4
    Storage Dry powder: Store at -20℃;After reconstitution store at 2°C‑8°C
    Purity ≥99%


      Product detail drawing  


      Shop Teriparatide CAS 52232-67-4 99% Purity Peptide Lyophilized Powder Factory Supply-Detailed Image 6 Shop Teriparatide CAS 52232-67-4 99% Purity Peptide Lyophilized Powder Factory Supply-Detailed Image 7 Shop Teriparatide CAS 52232-67-4 99% Purity Peptide Lyophilized Powder Factory Supply-Detailed Image 8 Shop Teriparatide CAS 52232-67-4 99% Purity Peptide Lyophilized Powder Factory Supply-Detailed Image 9



      Transportation and packaging  


    Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 10 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 11


    Factory detail map  


    Shop Teriparatide CAS 52232-67-4 99% Purity Peptide Lyophilized Powder Factory Supply-Detailed Image 12 Shop Teriparatide CAS 52232-67-4 99% Purity Peptide Lyophilized Powder Factory Supply-Detailed Image 13

    ECHEMI Editorial Reference
    The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
    Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.
    Research & Reference Note

    Teriparatide CAS 52232-67-4 99% Purity Peptide Lyophilized Powder Factory Supply is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • Teriparatide CAS 52232-67-4 99% Purity Peptide Lyophilized Powder Factory Supply Certificates 1 TDS

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Categories:

    Polypeptide

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    PEPTIDES

    Location:

    Room 305, 3rd Floor, Unit 2, Building 48, Datangxia Zone 2, Choucheng Subdistrict, Yiwu, Jinhua, Zhejiang Province, China

    Year of Establishment:

    2026

  • Inquiry History
    14 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    United States

    teriparatide

    1 G Sep 6, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    Russia

    Teriparatide

    1 G Sep 12, 2026
    Russia

    Teriparatide

    1 G Sep 12, 2026
    United States

    Teriparatide kit of 10 2mg vials

    1 MT Sep 7, 2026
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.