On ECHEMI

Yuzhen Peptide Co.,Limited

Zhejiang,China
Favorite Supplier
 519 people visit

Company Profile

Yuzhen Peptide Co.,Ltd. is the manufacturers of various biological peptides and the supplier and bio-technology service provider of pharmaceutical customs synthesis.

VIEW MORE VIEW LESS

Product List

Product Name Synonyms CAS No. Grate/Content Operate

Argireline

616204-22-9 Inquiry

Delta sleep-inducing peptide(DSIP)

62568-57-4 Inquiry

Epithalon/Epitalon 10mg for Anti-Aging

AE-0 peptide;Ala-Glu-Asp-Gly;alanyl-glutamyl-aspartyl-glycine;epitalon;epithalon;epithalone;307297-39-8;UNII-O65P17785G
307297-39-8 Inquiry

GHK/GHK-Cu

GHK Cu;GHK-Cu;L-Lysine,glycyl-L-histidyl-;L-Lysine,N2-(N-glycyl-L-histidyl)-;Glycyl-L-histidyl-L-lysine;Growth-modulating peptide (human);Growth-modulating peptide;Liver growth factor;Liver cell growth factor;18: PN: WO0004941 PAGE: 31 claimed protein;NSC 379527;9: PN: US20030229017 PAGE: 13 claimed protein;12: PN: FR2857667 SEQID: 8 claimed protein;13: PN: FR2857597 PAGE: 15 claimed protein;8: PN: WO2007068998 SEQID: 2 unclaimed protein;24: PN: KR20090132815 PAGE: 3 claimed protein;24: PN: KR20090132911 SEQID: 119 claimed protein;Kollaren;59: PN: WO2012103038 SEQID: 61 unclaimed protein;GHK Tripeptide;GHK;2: PN: KR20140126802 SEQID: 2 claimed protein;18: PN: KR20150027940 SEQID: 19 claimed protein;19: PN: KR20170136178 PAGE: 3 claimed sequence;15: PN: KR20190032250 SEQID: 15 claimed protein;4: PN: WO2020009548 SEQID: 4 claimed protein;98039-93-1
49557-75-7 Inquiry

Glucagon(1-29)Human

GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN
16941-32-5 Inquiry

IGF-1LR3

IGF-1 LR3;CL281;LR3-IGF1;IGF-1Lr3 Igtropin;LR3-IGF1 (100mcg/vial;IGF LR3-1;IDF-1 LR3;Recombinant Human Insulin-like Growth Factor-1 LR3, rhIGF-1
946870-92-4 Inquiry

Matrixyl

L-Serine, N2-(1-oxohexadecyl)-L-lysyl-L-threonyl-L-threonyl-L-lysyl-;Matrixyl(PAL-KTTKS);Pal-Lys-Thr-Thr-Lys-Ser-OH;N2-(1-Oxohexadecyl)-L-lysyl-L-threonyl-L-threonyl-L-lysyl-L-serine;Palmitoyl Pentapeptide PAL-Lys-Thr-Thr-Lys-Ser;PalMitoyl Pentapeptide-4;Matrixyl (Palmitoyl Pentapeptide);Matrixyl,Palmitoyl pentapeptide-4
214047-00-4 Inquiry

Melanotan-II (MT-II)

melanotan-II;Melanotan II;MT-II;Melanotan (MT)-II;Melatonan;Melanotan II acetate salt;CHEMBL430239;(3S,6S,9R,12S,15S,23S)-12-((1H-imidazol-5-yl)methyl)-3-((1H-indol-3-yl)methyl)-15-((S)-2-acetamidohexanamido)-9-benzyl-6-(3-guanidinopropyl)-2,5,8,11,14,17-hexaoxo-1,4,7,10,13,18-hexaazacyclotricosane-23-carboxamide;L-Lysinamide, N-acetyl-L-norleucyl-L-alpha-aspartyl-L-histidyl-D-phenylalanyl-L-arginyl-L-tryptophyl-, cyclic (2-7)-peptide
121062-08-6 Inquiry

Oxytocin

OT;OXT;pitons;OT-NPI;atonino;oxystin;pitocin;piton-s;utedrin;OXTOCIN
50-56-6 Inquiry

Snap-8

N-Acetyl-L-alpha-glutamyl-L-alpha-glutamyl-L-methionyl-L-glutaminyl-L-arginyl-L-arginyl-L-alanyl-L-alpha-asparagine;SNAP-8(AcetylGlutamylHeptapeptide-3);AcetylGluChemicalbooktaMylHeptapeptide-3;AcetylOctapeptide-3;AcetylGlutaMylOctapeptide-3;AcetylOctapetpide-3;snap-8/AcetylOctapeptide-3/AcetylGlutamylHeptapeptide-3;AcetylOctapeptide-8
868844-74-0 Inquiry

CONTACT INFORMATION

Send an inquiry

Product Name:
Quantity:
Shipment Term:

United States

  • China
  • Albania
  • Algeria
  • Angola
  • Anguilla
  • Antigua and Barbuda
  • Argentina
  • Armenia
  • Aruba
  • Australia
  • Austria
  • Azerbaijan
  • Bahamas
  • Bahrain
  • Bangladesh
  • Barbados
  • Belgium
  • Belize
  • Benin
  • Bermuda
  • Bhutan
  • Bolivia
  • Bosnia and Herzegovina
  • Botswana
  • Brazil
  • Brunei
  • Bulgaria
  • Burkina-faso
  • Burundi
  • Cameroon
  • Canada
  • Cape Verde
  • Cayman Islands
  • Central African
  • Chad
  • Chile
  • Colombia
  • Comoros
  • Cook Is.
  • Costa Rica
  • Croatia
  • Curacao
  • Cyprus
  • Czech
  • Democratic Republic of the Congo
  • Denmark
  • Djibouti
  • Dominica
  • Ecuador
  • Egypt
  • El Salvador
  • Equatorial Guinea
  • Eritrea
  • Estonia
  • Ethiopia
  • Faroe Islands
  • Fiji
  • Finland
  • France
  • French Guiana
  • French Polynesia
  • Gabon
  • Gambia
  • Georgia
  • Germany
  • Ghana
  • Gibraltar
  • Greece
  • Greenland
  • Grenada
  • Guadeloupe
  • Guam
  • Guatemala
  • Guinea
  • Guinea-Bissau
  • Guyana
  • Haiti
  • Honduras
  • Hongkong, China
  • Hungary
  • Iceland
  • India
  • Indonesia
  • Ireland
  • Israel
  • Italy
  • Ivory Coast
  • Jamaica
  • Japan
  • Jordan
  • Kampuchea (Cambodia )
  • Kazakstan
  • Kenya
  • Kiribati
  • Kosovo
  • Kuwait
  • Kyrgyzstan
  • Laos
  • Latvia
  • Lebanon
  • Lesotho
  • Liberia
  • Liechtenstein
  • Lithuania
  • Luxembourg
  • Macao, China
  • Madagascar
  • Malawi
  • Malaysia
  • Maldives
  • Mali
  • Malta
  • Marshall Island
  • Martinique
  • Mauritania
  • Mauritius
  • Mayotte
  • Mexico
  • Micronesia
  • Moldova
  • Monaco
  • Mongolia
  • Montenegro
  • Montserrat
  • Morocco
  • Mozambique
  • Myanmar
  • Namibia
  • Nauru
  • Nepal
  • Netherlands
  • Netherlands Antilles
  • New Caledonia
  • New Zealand
  • Nicaragua
  • Niger
  • Nigeria
  • Norfolk Island
  • North Macedonia
  • Norway
  • Oman
  • Pakistan
  • Palau
  • Palestine
  • Panama
  • Papua New Cuinea
  • Paraguay
  • Peru
  • Philippines
  • Poland
  • Portugal
  • Puerto Rico
  • Qatar
  • Republic of the Congo
  • Reunion Island
  • Romania
  • Russia
  • Rwanda
  • Saint Kitts and Nevis
  • Saint Martin
  • Saint Vincent and the Grenadines
  • Samoa
  • San Marino
  • Sao Tome and Principe
  • Saudi Arabia
  • Senegal
  • Serbia
  • Seychelles
  • Sierra Leone
  • Singapore
  • Slovakia
  • Slovenia
  • Solomon Is
  • Somali
  • South Africa
  • South Korea
  • South Sudan
  • Spain
  • Sri Lanka
  • St.Lucia
  • Suriname
  • Swaziland
  • Sweden
  • Switzerland
  • Taiwan, China
  • Tajikstan
  • Tanzania
  • Thailand
  • The British Virgin Islands
  • The Dominican Republic
  • The Islamic Republic of Mauritania
  • The Islands of st pierre and miquelon
  • The Turks and Caicos Islands
  • Timor-Leste
  • Togo
  • Tonga
  • Trinidad and Tobago
  • Tunisia
  • Turkey
  • Turkmenistan
  • Tuvalu
  • Uganda
  • United Arab Emirates
  • United Kingdom
  • United States
  • Uruguay
  • Uzbekistan
  • Vanuatu
  • Vatican
  • Vietnam
  • Wallis et Futuna
  • Western Sahara
  • Yemen
  • Zaire
  • Zambia
  • Zimbabwe
  • Afghanistan
  • Belarus
  • Cuba
  • Iran
  • Iraq
  • Libya
  • North Korea
  • Sudan
  • Syria
  • Ukraine
  • Venezuela
Message:
0/2000
Accept quotations from other qualified suppliers on ECHEMI.com

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.