On ECHEMI

HangZhou hanzpharm co.,limited

Hangzhou,Zhejiang,China
Favorite Supplier
 838 people visit

Company Profile

Hangzhou Hanz Pharm co.,ltd specialized in producing and exporting Pharmaceutical Intermediates which is located in hangzhou,china, we are developing, manufacturing and exporting advanced pharmaceutical intermediates

VIEW MORE VIEW LESS

Product List

Product Name Synonyms CAS No. Grate/Content Operate

2,5-Diaminotoluene sulfate

1,4-Benzenediamine,2-methyl-,sulfate (1:1);Toluene-2,5-diamine,sulfate (1:1);2,5-Diaminotoluene sulfate;C.I. 76043;NSC 1703;2-Methylbenzene-1,4-diamine sulfate;62488-20-4
615-50-9 Industrial Grade, Pharma Grade / 99.5% Inquiry

2,5-Dihydroxyterephthalic acid

1,4-Benzenedicarboxylic acid,2,5-dihydroxy-;Terephthalic acid,2,5-dihydroxy-;2,5-Dihydroxy-1,4-benzenedicarboxylic acid;2,5-Dihydroxyterephthalic acid;Hydroquinone-2,5-dicarboxylic acid;NSC 407960;DHTA
610-92-4 Industrial Grade / 99% Inquiry

3-Amino-4-hydroxybenzoic acid

Benzoic acid,3-amino-4-hydroxy-;3-Amino-4-hydroxybenzoic acid;4-Hydroxy-3-aminobenzoic acid;NSC 700601;3-Amino-4-hydroxylbenzoic acid
1571-72-8 Industrial Grade, Pharma Grade / 98% Inquiry

ACTH(1-39)

CORTICOTROPIN (HUMAN);CORTICOTROPHIN;CORTICOTROPIN A;H-SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE-OH;ACTH (1-39), HUMAN;ACTH 1-39;ACTH;ADRENOCORTICOTROPIC HORMONE HUMAN
12279-41-3 - / 99.5% Inquiry

Epithalon

AE-0 peptide;Ala-Glu-Asp-Gly;alanyl-glutamyl-aspartyl-glycine;epitalon;epithalon;epithalone;307297-39-8;UNII-O65P17785G
307297-39-8 - / 99.5% Inquiry

Glucagon

GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN
16941-32-5 - / 99.5% Inquiry

high quailty 872-50-4 good suppiler,872-50-4 NMP cost

2-Pyrrolidinone,1-methyl-;2-Pyrrolidone,1-methyl-;1-Methyl-2-pyrrolidinone;N-Methylpyrrolidinone;1-Methyl-5-pyrrolidinone;NMP;N-Methyl-2-pyrrolidone;N-Methyl-α-pyrrolidinone;N-Methyl-α-pyrrolidone;N-Methyl-γ-butyrolactam;N-Methyl-2-pyrrolidinone;N-Methylpyrrolidone;M-Pyrol;1-Methylazacyclopentan-2-one;1-Methyl-2-pyrrolidone;Pyrol M;N-Methylpyrrolidone;AgsolEx 1;N 0131;Microposit 2001;N-Methyl-2-ketopyrrolidine;N-Methylbutyrolactam;Pharmasolve;SL 1332;NSC 4594;N-Methylpyrrolidine-2-one;M 0418;EKOS 1;NMP 1165;26138-58-9;53774-35-9;57762-46-6
872-50-4 Industrial Grade, Pharma Grade / 99.5% Inquiry

high quality 1364933-55-0 manufacturer,THJ018 in China

Methanone,1-naphthalenyl(1-pentyl-1H-indazol-3-yl)-;1-Naphthalenyl(1-pentyl-1H-indazol-3-yl)methanone;THJ 018
1364933-55-0 Industrial Grade, Pharma Grade / 99.9% Inquiry

Hot sale 135463-81-9 good supplier,Coluracetam Flubendazole cost

1-Pyrrolidineacetamide,2-oxo-N-(5,6,7,8-tetrahydro-2,3-dimethylfuro[2,3-b]quinolin-4-yl)-;Furo[2,3-b]quinoline,1-pyrrolidineacetamide deriv.;2-Oxo-N-(5,6,7,8-tetrahydro-2,3-dimethylfuro[2,3-b]quinolin-4-yl)-1-pyrrolidineacetamide;MKC 231;Coluracetam
135463-81-9 Industrial Grade, Pharma Grade / 99% Inquiry

IGF-1LR3

IGF-1 LR3;CL281;LR3-IGF1;IGF-1Lr3 Igtropin;LR3-IGF1 (100mcg/vial;IGF LR3-1;IDF-1 LR3;Recombinant Human Insulin-like Growth Factor-1 LR3, rhIGF-1
946870-92-4 Pharma Grade / 99% Inquiry

Melanotan?I

75921-69-6 - / 99.5% Inquiry

Melanotan?II

melanotan-II;Melanotan II;MT-II;Melanotan (MT)-II;Melatonan;Melanotan II acetate salt;CHEMBL430239;(3S,6S,9R,12S,15S,23S)-12-((1H-imidazol-5-yl)methyl)-3-((1H-indol-3-yl)methyl)-15-((S)-2-acetamidohexanamido)-9-benzyl-6-(3-guanidinopropyl)-2,5,8,11,14,17-hexaoxo-1,4,7,10,13,18-hexaazacyclotricosane-23-carboxamide;L-Lysinamide, N-acetyl-L-norleucyl-L-alpha-aspartyl-L-histidyl-D-phenylalanyl-L-arginyl-L-tryptophyl-, cyclic (2-7)-peptide
121062-08-6 - / 99.5% Inquiry

METHYL THIOSALICYLATE

Benzoic acid,2-mercapto-,methyl ester;Benzoic acid,o-mercapto-,methyl ester;Methyl thiosalicylate;Methyl 2-mercaptobenzoate;Methyl o-mercaptobenzoate;2-(Methoxycarbonyl)thiophenol;2-Mercaptobenzoic acid methyl ester;Methyl 2-thiosalicylate;NSC 30156;2-(Methoxycarbonyl)benzenethiol;Thiosalicylic acid methyl ester;Methyl 2-sulfanylbenzoate
4892-02-8 Industrial Grade, Pharma Grade / 97% Inquiry

Oxytocin

OT;OXT;pitons;OT-NPI;atonino;oxystin;pitocin;piton-s;utedrin;OXTOCIN
50-56-6 - / 99.5% Inquiry

S-Methyl methanethiolsulfonate

Methanesulfonothioic acid,S-methyl ester;Methanesulfonic acid,thio-,S-methyl ester;S-Methyl methanethiosulfonate;Methyl methanethiolsulfonate;S-Methyl methanesulfonothioate;Methyl methanesulfonothioate;NSC 21545;S-Methyl methanethiolsulfonate;(Methanesulfonylsulfanyl)methane;117991-82-9;31761-75-8
2949-92-0 Industrial Grade, Pharma Grade / 98% Inquiry

Supply/lowest price 59-50-7 hot sale

Phenol,4-chloro-3-methyl-;m-Cresol,4-chloro-;4-Chloro-3-methylphenol;2-Chloro-5-hydroxytoluene;6-Chloro-3-hydroxytoluene;3-Methyl-4-chlorophenol;Parol;PCMC;Raschit;Raschit K;Preventol CMK;4-Chloro-5-methylphenol;Baktol;Baktolan;Ottafact;Rasen-Anicon;Aptal;Candaseptic;Peritonan;para-Chloro-meta-cresol;Chlorocresol;4-Chloro-3-cresol;1-Chloro-2-methyl-4-hydroxybenzene;p-Chloro-m-cresol;Neopredisan;4-Chloro-m-cresol;NSC 4166;Parmetol;Aldecoc XD;3-Methyl-p-chlorophenol
59-50-7 Industrial Grade, Pharma Grade / 99.5% Inquiry

CONTACT INFORMATION

Send an inquiry

Product Name:
Quantity:
Shipment Term:

United States

  • China
  • Albania
  • Algeria
  • Angola
  • Anguilla
  • Antigua and Barbuda
  • Argentina
  • Armenia
  • Aruba
  • Australia
  • Austria
  • Azerbaijan
  • Bahamas
  • Bahrain
  • Bangladesh
  • Barbados
  • Belgium
  • Belize
  • Benin
  • Bermuda
  • Bhutan
  • Bolivia
  • Bosnia and Herzegovina
  • Botswana
  • Brazil
  • Brunei
  • Bulgaria
  • Burkina-faso
  • Burundi
  • Cameroon
  • Canada
  • Cape Verde
  • Cayman Islands
  • Central African
  • Chad
  • Chile
  • Colombia
  • Comoros
  • Cook Is.
  • Costa Rica
  • Croatia
  • Curacao
  • Cyprus
  • Czech
  • Democratic Republic of the Congo
  • Denmark
  • Djibouti
  • Dominica
  • Ecuador
  • Egypt
  • El Salvador
  • Equatorial Guinea
  • Eritrea
  • Estonia
  • Ethiopia
  • Faroe Islands
  • Fiji
  • Finland
  • France
  • French Guiana
  • French Polynesia
  • Gabon
  • Gambia
  • Georgia
  • Germany
  • Ghana
  • Gibraltar
  • Greece
  • Greenland
  • Grenada
  • Guadeloupe
  • Guam
  • Guatemala
  • Guinea
  • Guinea-Bissau
  • Guyana
  • Haiti
  • Honduras
  • Hongkong, China
  • Hungary
  • Iceland
  • India
  • Indonesia
  • Ireland
  • Israel
  • Italy
  • Ivory Coast
  • Jamaica
  • Japan
  • Jordan
  • Kampuchea (Cambodia )
  • Kazakstan
  • Kenya
  • Kiribati
  • Kosovo
  • Kuwait
  • Kyrgyzstan
  • Laos
  • Latvia
  • Lebanon
  • Lesotho
  • Liberia
  • Liechtenstein
  • Lithuania
  • Luxembourg
  • Macao, China
  • Madagascar
  • Malawi
  • Malaysia
  • Maldives
  • Mali
  • Malta
  • Marshall Island
  • Martinique
  • Mauritania
  • Mauritius
  • Mayotte
  • Mexico
  • Micronesia
  • Moldova
  • Monaco
  • Mongolia
  • Montenegro
  • Montserrat
  • Morocco
  • Mozambique
  • Myanmar
  • Namibia
  • Nauru
  • Nepal
  • Netherlands
  • Netherlands Antilles
  • New Caledonia
  • New Zealand
  • Nicaragua
  • Niger
  • Nigeria
  • Norfolk Island
  • North Macedonia
  • Norway
  • Oman
  • Pakistan
  • Palau
  • Palestine
  • Panama
  • Papua New Cuinea
  • Paraguay
  • Peru
  • Philippines
  • Poland
  • Portugal
  • Puerto Rico
  • Qatar
  • Republic of the Congo
  • Reunion Island
  • Romania
  • Russia
  • Rwanda
  • Saint Kitts and Nevis
  • Saint Martin
  • Saint Vincent and the Grenadines
  • Samoa
  • San Marino
  • Sao Tome and Principe
  • Saudi Arabia
  • Senegal
  • Serbia
  • Seychelles
  • Sierra Leone
  • Singapore
  • Slovakia
  • Slovenia
  • Solomon Is
  • Somali
  • South Africa
  • South Korea
  • South Sudan
  • Spain
  • Sri Lanka
  • St.Lucia
  • Suriname
  • Swaziland
  • Sweden
  • Switzerland
  • Taiwan, China
  • Tajikstan
  • Tanzania
  • Thailand
  • The British Virgin Islands
  • The Dominican Republic
  • The Islamic Republic of Mauritania
  • The Islands of st pierre and miquelon
  • The Turks and Caicos Islands
  • Timor-Leste
  • Togo
  • Tonga
  • Trinidad and Tobago
  • Tunisia
  • Turkey
  • Turkmenistan
  • Tuvalu
  • Uganda
  • United Arab Emirates
  • United Kingdom
  • United States
  • Uruguay
  • Uzbekistan
  • Vanuatu
  • Vatican
  • Vietnam
  • Wallis et Futuna
  • Western Sahara
  • Yemen
  • Zaire
  • Zambia
  • Zimbabwe
  • Afghanistan
  • Belarus
  • Cuba
  • Iran
  • Iraq
  • Libya
  • North Korea
  • Sudan
  • Syria
  • Ukraine
  • Venezuela
Message:
0/2000
Accept quotations from other qualified suppliers on ECHEMI.com

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.