On ECHEMI

Sichuan Jisheng Biotechnology Co.,Ltd

/
Favorite Supplier
 334 people visit

Company Profile

Sichuan Jisheng Biopharmaceutical Co., Ltd is located in high-tech industrial zone of Leshan, Sichuan province, which is nearby the famous beautiful scene of Mount Emei and Leshan Giant Buddha, and the traffic is convenient, exit of chengmianle high-speed road. Covering an area of 50,000 square meters.And Sichuan Elegbacaepharm Co., Ltd was founded in 2005,has a pharmaceutical production license and get a new version of GMP certificate.We are a professional enterprise for research, development, customizing manufacture, services and trade of biochemical reagent, health medicine, intermediates, pharmaceutical raw materials and health medicine raw materials. We have invested 120 millions for the modernizing production facility, equipments and advanced detecting instruments, which greatly improve our production capacity and inspection ability.Our modernized workshop buildings are according to GMP standards. Our products have exceeded in international quality standards with our perfect equipment, advanced detecting instruments, excellent staff, stable producing process and first-rate quality control system.Meanwhile, We established the drug innovation center with our strategic cooperation partner of the Chinese Academy of Science, Southwest University of science and Technology, Leshan Normal University, which has the first-class equipment of Nuclear Magnetic Resonance, Mass Spectrograph ,GC-MS& LC-MS and HPLC. All of the staff in this center are professionals and we have 8 professors,4 doctors and 6 graduate students. Our drug innovation center is specializing of R&D new drugs and customizing synthesis of all kinds of biochemical drug, natural active pharmaceutical ingredients, and have ability of new drug applications.Since established, we set up the stable business relationship with many drug manufacturers, institutes studies and international chemical companies. If you are interesting in any of our products or would like to discuss a custom order, please feel free to contact us. We are looking forward to forming successful business relationship with new customer around the world in the future.

VIEW MORE VIEW LESS

Product List

Product Name Synonyms CAS No. Grate/Content Operate

(2S)-2-[[(2S)-1-[(2S)-5-amino-2-[[2-(hexadecanoylamino)acetyl]amino]-5-oxopentanoyl]pyrrolidine-2-carbonyl]amino]-5-(diaminomethylideneamino)pentanoic acid

Matrixyl 3000/Palmitoyl Tetrapeptide-3;N-Palmitoylrigin;Palm-GQPR;Palmitoyl-GQPR;(S)-2-[(S)-1-[(S)-5-Amino-5-oxo-2-(2-palmitamidoacetamido)pentanoyl]pyrrolidine-2-carboxamido]-5-[(diaminomethylene)amino]pentanoic Acid;L-Arginine, N-(1-oxohexadecyl)glycyl-L-glutaminyl-L-prolyl-;Pal-tetrapeptide-3(7)+ Dipeptide-2;Palmitoyl Tetrapeptide-7(Pal-GQPR)
221227-05-0 Inquiry

(2S,4R)-1-hexadecanoyl-4-hexadecanoyloxypyrrolidine-2-carboxylic acid

L-Proline,1-(1-oxohexadecyl)-4-[(1-oxohexadecyl)oxy]-,(4R)-;L-Proline,1-(1-oxohexadecyl)-4-[(1-oxohexadecyl)oxy]-,trans-;(4R)-1-(1-Oxohexadecyl)-4-[(1-oxohexadecyl)oxy]-L-proline;O,N-Dipalmitoylhydroxyproline;Lipacide DPHP;Sepilift DPHP;DPHP;Simulgel DPHP;1,4-Dipalmitoyl hydroxyproline
41672-81-5 Inquiry

(3S)-3-[[(2S)-2-acetamido-5-amino-5-oxopentanoyl]amino]-4-[[(2S)-1-[[(1S)-1-carboxy-2-(1H-imidazol-5-yl)ethyl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-oxobutanoic acid

Acetyl tetrapeptide-9(Dermican LS 9837);N2-Acetyl-L-glutaminyl-L-alpha-aspartyl-L-valyl-L-histidine;cetyl tetrapeptide-9/Dermican LS 9837;(3S)-3-[[(2S)-2-acetamido-5-amino-5-oxopentanoyl]amino]-4-[[(2S)-1-[[(1S)-1-carboxy-2-(1H-imidazol-5-yl)ethyl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-oxobutanoic acid;Acetyl Tetrapeptide-9, Dermican;L-Histidine, N2-acetyl-L-glutaminyl-L-α-aspartyl-L-valyl-;Acetyl Tetrapeptide-9 USP/EP/BP;Supply Top Quality Cosmetic Peptide Acetyl Tetrapeptide-9 Anti-Aging and Skin Smoothing CAS 928006-50-2
928006-50-2 Inquiry

127317-03-7

HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2;HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2;H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2;[ARG14,20,21, LEU16] PACAP (1-27), HUMAN, OVINE, RAT;[ARG14,20,21, LEU16] PITUITARY ADENYLATE CYCLASE ACTIVATING PEPTIDE (1-27), HUMAN, OVINE, RAT;ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE-27 OVINE;ADENYLATE CYCLASE ACTIVATING PEPTIDE-27;pituitary adenylate cyclase activating*polypeptid
127317-03-7 Inquiry

2-[[2-[[2-[[2-[[2-amino-3-(4-hydroxyphenyl)propanoyl]amino]acetyl]amino]acetyl]amino]-3-phenylpropanoyl]amino]-4-methylsulfanylbutanoic acid

porcine,beta-endorphin1-5;[Met5]Enkephalin acetate salt hydrate;methionine enkephalin acetate;N-[N-[N-(N-L-tyrosylglycyl)glycyl]-L-phenylalanyl]-L-methionine;(methionine5)enkephalin;[5-Methionin]Enkephalin,EnkephalinM;[Met5]Enkephalinhydrateacetatesalt;TYR-GLY-GLY-PHE-MET H2O
58569-55-4 Inquiry

Angiotensin

Angiotensin;Angiotonin;Angiotensins;1405-70-5;12642-17-0
1407-47-2 Inquiry

Melanostatine

158563-45-2 Inquiry

CONTACT INFORMATION

Send an inquiry

Product Name:
Quantity:
Shipment Term:

United States

  • China
  • Albania
  • Algeria
  • Angola
  • Anguilla
  • Antigua and Barbuda
  • Argentina
  • Armenia
  • Aruba
  • Australia
  • Austria
  • Azerbaijan
  • Bahamas
  • Bahrain
  • Bangladesh
  • Barbados
  • Belgium
  • Belize
  • Benin
  • Bermuda
  • Bhutan
  • Bolivia
  • Bosnia and Herzegovina
  • Botswana
  • Brazil
  • Brunei
  • Bulgaria
  • Burkina-faso
  • Burundi
  • Cameroon
  • Canada
  • Cape Verde
  • Cayman Islands
  • Central African
  • Chad
  • Chile
  • Colombia
  • Comoros
  • Cook Is.
  • Costa Rica
  • Croatia
  • Curacao
  • Cyprus
  • Czech
  • Democratic Republic of the Congo
  • Denmark
  • Djibouti
  • Dominica
  • Ecuador
  • Egypt
  • El Salvador
  • Equatorial Guinea
  • Eritrea
  • Estonia
  • Ethiopia
  • Faroe Islands
  • Fiji
  • Finland
  • France
  • French Guiana
  • French Polynesia
  • Gabon
  • Gambia
  • Georgia
  • Germany
  • Ghana
  • Gibraltar
  • Greece
  • Greenland
  • Grenada
  • Guadeloupe
  • Guam
  • Guatemala
  • Guinea
  • Guinea-Bissau
  • Guyana
  • Haiti
  • Honduras
  • Hongkong, China
  • Hungary
  • Iceland
  • India
  • Indonesia
  • Ireland
  • Israel
  • Italy
  • Ivory Coast
  • Jamaica
  • Japan
  • Jordan
  • Kampuchea (Cambodia )
  • Kazakstan
  • Kenya
  • Kiribati
  • Kosovo
  • Kuwait
  • Kyrgyzstan
  • Laos
  • Latvia
  • Lebanon
  • Lesotho
  • Liberia
  • Liechtenstein
  • Lithuania
  • Luxembourg
  • Macao, China
  • Madagascar
  • Malawi
  • Malaysia
  • Maldives
  • Mali
  • Malta
  • Marshall Island
  • Martinique
  • Mauritania
  • Mauritius
  • Mayotte
  • Mexico
  • Micronesia
  • Moldova
  • Monaco
  • Mongolia
  • Montenegro
  • Montserrat
  • Morocco
  • Mozambique
  • Myanmar
  • Namibia
  • Nauru
  • Nepal
  • Netherlands
  • Netherlands Antilles
  • New Caledonia
  • New Zealand
  • Nicaragua
  • Niger
  • Nigeria
  • Norfolk Island
  • North Macedonia
  • Norway
  • Oman
  • Pakistan
  • Palau
  • Palestine
  • Panama
  • Papua New Cuinea
  • Paraguay
  • Peru
  • Philippines
  • Poland
  • Portugal
  • Puerto Rico
  • Qatar
  • Republic of the Congo
  • Reunion Island
  • Romania
  • Russia
  • Rwanda
  • Saint Kitts and Nevis
  • Saint Martin
  • Saint Vincent and the Grenadines
  • Samoa
  • San Marino
  • Sao Tome and Principe
  • Saudi Arabia
  • Senegal
  • Serbia
  • Seychelles
  • Sierra Leone
  • Singapore
  • Slovakia
  • Slovenia
  • Solomon Is
  • Somali
  • South Africa
  • South Korea
  • South Sudan
  • Spain
  • Sri Lanka
  • St.Lucia
  • Suriname
  • Swaziland
  • Sweden
  • Switzerland
  • Taiwan, China
  • Tajikstan
  • Tanzania
  • Thailand
  • The British Virgin Islands
  • The Dominican Republic
  • The Islamic Republic of Mauritania
  • The Islands of st pierre and miquelon
  • The Turks and Caicos Islands
  • Timor-Leste
  • Togo
  • Tonga
  • Trinidad and Tobago
  • Tunisia
  • Turkey
  • Turkmenistan
  • Tuvalu
  • Uganda
  • United Arab Emirates
  • United Kingdom
  • United States
  • Uruguay
  • Uzbekistan
  • Vanuatu
  • Vatican
  • Vietnam
  • Wallis et Futuna
  • Western Sahara
  • Yemen
  • Zaire
  • Zambia
  • Zimbabwe
  • Afghanistan
  • Belarus
  • Cuba
  • Iran
  • Iraq
  • Libya
  • North Korea
  • Sudan
  • Syria
  • Ukraine
  • Venezuela
Message:
0/2000
Accept quotations from other qualified suppliers on ECHEMI.com

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.