Calcitonin Acetate (Salmon) 98%
1 Inquiries
47931-85-1
Pharmaceutical Grade
98%
SHANGHAI
0.001kg/0.10kg Bottle
2018-12-31
Cosmetic raw material, peptide, API
-
Product Description
-
Seller Information
-
Inquiry History
-
Description
Calcitonin Acetate(Salmon)
Cas No: 47931-85-1(net)
FormulaC145H240N44O48S2
Molecular: 3431.85
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Calcihexal, Calcimar, Cibacalcin, Fortical, Miacalcin, Salcatonin,
Basic Info-
Product Name:
Calcitonin Acetate(Salmon)
CAS No.:47931-85-1
Molecular Formula:C145H240N44O48S2
Molecular Weight:3431.85
HScode:2937190000
Characteristics-
Density:
1.54±0.1 g/cm3(Predicted)
Water Solubility:Soluble in water at 1mg/ml
Hazard IdentificationClassification of the substance or mixture
Acute toxicity - Category 3, Oral
GHS label elements, including precautionary statements
Pictogram(s)
Signal word Danger
Hazard statement(s) H301 Toxic if swallowed
Precautionary statement(s) Prevention P264 Wash ... thoroughly after handling.
P270 Do not eat, drink or smoke when using this product.
Response P301+P316 IF SWALLOWED: Get emergency medical help immediately.
P321 Specific treatment (see ... on this label).
P330 Rinse mouth.
Storage P405 Store locked up.
Disposal P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.
Other hazards which do not result in classification
no data available
Handling and StoragePrecautions for safe handling
Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.
Conditions for safe storage, including any incompatibilities
Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.
-
-
Seller Information
-
Business Type:
Distributor
-
Main Products:
Cosmetic raw material, peptide, API
-
Location:
6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone,Chengdu,China 610000
-
Payment Terms:
TT against copy of documents
-
Average lead Time:
60
-
Total Annual Revenue:
$2.5 million-$5 million
-
Total Employees:
11-50
-
Year of Establishment:
2015
Chengdu YoungShe Chemical Co., Ltd. was established in 2015. It is a new and dynamic high-tech enterprise that continuously innovates and specializes in the research, development, production and sales of peptide cosmetic raw materials. It has customers all over the world. Chengdu Yunxi, heart to heart, heart peptide, and heart service. After several years of research, Chengdu Yunxi has developed hundreds of cosmetic peptides with various functions, basically covering all commercially available cosmetic peptide varieties. Chengdu Youngshe Chemical Co., Ltd. as a domestic professional supplier of cosmetic peptide raw materials, our cosmetic peptides mainly include: breast enhancement peptide (Liptide), light skin peptide (Lightide), whitening peptide (Whitide) 、Lashtide、Argitide、Eyelitide、Eyestide、Matritide、Matritide3000、Collatide and hair growth peptide (Hairtide), Copper Peptide, Desentide, Calmtide, Rebasetide, Deretide, Moistide, Despotide ), Elastide, Descartide, Snaptide, Aketide, Carnosine, EGF peptide, Ingactide, young peptide ( youngtide, Firmtide, Stretide, Keratide, Antiuvtide, Lashtide-plus, Eyestide-Plus , Compound whitening peptide (Whitide-Plus), Compound wrinkle-Plus, Compound anti-allergic peptide (Desentide-Plus), Compound repair peptide (Repair-Plus), etc. Quality, service and credibility are Yunxi's corporate purpose and fundamental survival, and customer satisfaction is Yunxi's ultimate goal. Regardless of whether you have used Chengdu Yunxi's beauty peptide products, each of our employees will welcome your consultation with sincerity and enthusiasm. Chengdu Yunxi, your reliable partner for beauty peptides.
-
-
Inquiry History1 Inquiries
Country Product Purchase Quantity Date Posted
Vietnam
Calcitonin salmon supplier API Pharmaceutical Polypeptide Protected amino acids made in china
100 G Jul 19, 2023 Post an enquiry for this product