Calcitonin Acetate(Salmon) 98% white powder CAS 47931-85-1/ Youngshe

1. Name:Calcitonin Acetate(Salmon)

   Cas No: 47931-85-1(net)

   Formula: C145H240N44O48S2

   Molecular: 3431.85

   Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP

   Purity:98%

   Appearance: white powder

   Source: synthetic

   Also known as: Calcihexal, Calcimar, Cibacalcin, Fortical, Miacalcin, Salcatonin,

1. Professionalism of production: With more than 20 years of experience in peptide production, to ensure the stability and reliability of each batch of peptide quality.

2. Professionalism of product efficacy: We are familiar with more than 300 kinds of cosmetic peptides that are now available worldwide, thorough research.

3.Professionalism of service: customer satisfaction is our greatest work.

4. Reliability: We always believe that only good reputation and product quality can make a good company.

5. Flexibility: We offer a variety of peptides, liquid, freeze-dried powder etc.

6. Variety of products: We offer more than 200 peptides, including Dipeptide, Tripeptide, Tetrapeptide, Pentapeptide, Hexapeptide, Heptapeptide,Octapeptide,Nonapeptide,Decapeptide,Copper peptide, Oligopeptide and so on.

Q1: How do I make an order?
A: Please contact with us and we will be happy to  assist you with your order.

Q2: How to start orders or make payments?
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.We accept T/T (Telegraphic  Transfer), or Paypal.

Q3: How about delivery lead time?
A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)

Q4:Is there a discount?
A:Different quantity has different discount

Q5: How do you treat quality complaint?
A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.

Other hot-selling Ingredients:

Anti-wrinkle peptide

Anti-aging peptide

Skin whitening peptide

Anti-oxidant peptide

Hair/Eyelash/Eyebrow peptide

Anti-eyebags Anti-dark circle peptide

Anti-inflammatory Anti-sensitive peptide

Anti-ance Anti-microbial peptide

Anti-cellulite and slimming peptide

Breast firming and facial redefining peptide

... ...

Chengdu Youngshe Chemical Co. Ltd is is a dynamic and progressive peptide and protein manufacturer in China. We are dedicated to be one of the most professional, efficient,and reliable partner for global customers on peptides and proteins. Youngshe has developed more than 2000 kinds of cosmetic peptides. catalog peptides,peptide intermediates, proteins, etc.. And we are keeping developing new products and continuously marketing them for sale.Youngshe provide a one-stop service for peptide and protein. Youngshe will do whatever they can to save your time ,energy, money and make you a pleasant experience with us.

Contact

Aileen Chen

Email: aileen@youngshechem.com

WhatsApp/WeChat: +8619150309904