Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > Calcitonin Acetate(Salmon) for Sale > Calcitonin Acetate(Salmon) 98% white powder CAS 47931-85-1/ Youngshe
Calcitonin Acetate(Salmon) 98% white powder CAS 47931-85-1/ Youngshe buy - large image1
Calcitonin Acetate(Salmon) 98% white powder CAS 47931-85-1/ Youngshe buy - image1
Calcitonin Acetate(Salmon) 98% white powder CAS 47931-85-1/ Youngshe buy - image2
Calcitonin Acetate(Salmon) 98% white powder CAS 47931-85-1/ Youngshe buy - image3
Calcitonin Acetate(Salmon) 98% white powder CAS 47931-85-1/ Youngshe buy - image4
Calcitonin Acetate(Salmon) 98% white powder CAS 47931-85-1/ Youngshe buy - image5
Calcitonin Acetate(Salmon) 98% white powder CAS 47931-85-1/ Youngshe buy - image6

Calcitonin Acetate(Salmon) 98% white powder CAS 47931-85-1/ Youngshe

1 Inquiries

Unit Price:

$20-25/UNIT FOB

Get Latest Price
CAS No.:

47931-85-1

Grade:

Chemical Grade

Content:

98%

Port:

chengdu

Brand:

Youngshe

Packaging:

Plastic bottle

Price valid (until):

2030-12-30

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

Cosmetic peptides,beauty raw materials,custom peptides,pharmaceutical intermediates

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    1. Name:Calcitonin Acetate(Salmon)

      Cas No: 47931-85-1(net)

      Formula: C145H240N44O48S2

      Molecular: 3431.85

      Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP

      Purity:98%

      Appearance: white powder

      Source: synthetic

      Also known as: Calcihexal, Calcimar, Cibacalcin, Fortical, Miacalcin, Salcatonin,



    Shop Calcitonin Acetate(Salmon) 98% white powder CAS 47931-85-1/ Youngshe-Detailed Image 1


      Company Profile 


    Shop Calcitonin Acetate(Salmon) 98% white powder CAS 47931-85-1/ Youngshe-Detailed Image 2
    Shop Calcitonin Acetate(Salmon) 98% white powder CAS 47931-85-1/ Youngshe-Detailed Image 3


      Our Advantages  


    1. Professionalism of production: With more than 20 years of experience in peptide production, to ensure the stability and reliability of each batch of peptide quality.


    2. Professionalism of product efficacy: We are familiar with more than 300 kinds of cosmetic peptides that are now available worldwide, thorough research.


    3.Professionalism of service: customer satisfaction is our greatest work.


    4. Reliability: We always believe that only good reputation and product quality can make a good company.


    5. Flexibility: We offer a variety of peptides, liquid, freeze-dried powder etc.


    6. Variety of products: We offer more than 200 peptides, including Dipeptide, Tripeptide, Tetrapeptide, Pentapeptide, Hexapeptide, Heptapeptide,Octapeptide,Nonapeptide,Decapeptide,Copper peptide, Oligopeptide and so on.


    Shop Calcitonin Acetate(Salmon) 98% white powder CAS 47931-85-1/ Youngshe-Detailed Image 4


    Packaging & Shipping  


    Shop Calcitonin Acetate(Salmon) 98% white powder CAS 47931-85-1/ Youngshe-Detailed Image 5


      F&Q 


    Q1: How do I make an order?
    A: Please contact with us and we will be happy to  assist you with your order.

    Q2: How to start orders or make payments?
    A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.We accept T/T (Telegraphic  Transfer), or Paypal.

    Q3: How about delivery lead time?
    A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)

    Q4:Is there a discount?
    A:Different quantity has different discount

    Q5: How do you treat quality complaint?
    A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.


    Other hot-selling Ingredients:

    Anti-wrinkle peptide

    Anti-aging peptide

    Skin whitening peptide

    Anti-oxidant peptide

    Hair/Eyelash/Eyebrow peptide

    Anti-eyebags Anti-dark circle peptide

    Anti-inflammatory Anti-sensitive peptide

    Anti-ance Anti-microbial peptide

    Anti-cellulite and slimming peptide

    Breast firming and facial redefining peptide

    ... ...

    Chengdu Youngshe Chemical Co. Ltd is is a dynamic and progressive peptide and protein manufacturer in China. We are dedicated to be one of the most professional, efficient,and reliable partner for global customers on peptides and proteins. Youngshe has developed more than 2000 kinds of cosmetic peptides. catalog peptides,peptide intermediates, proteins, etc.. And we are keeping developing new products and continuously marketing them for sale.Youngshe provide a one-stop service for peptide and protein. Youngshe will do whatever they can to save your time ,energy, money and make you a pleasant experience with us.

    Contact

    Aileen Chen

    Email: aileen@youngshechem.com

    WhatsApp/WeChat: +8619150309904


    Basic Info
    Product Name:

    Calcitonin Acetate(Salmon)

    CAS No.:

    47931-85-1

    Molecular Formula:

    C145H240N44O48S2

    Molecular Weight:

    3431.85

    HScode:

    2937190000

    Categories:

    Polypeptide

    Characteristics
    Density:

    1.54±0.1 g/cm3(Predicted)

    Water Solubility:

    Soluble in water at 1mg/ml

    Hazard Identification

    Classification of the substance or mixture

    Acute toxicity - Category 3, Oral

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Danger

    Hazard statement(s)

    H301 Toxic if swallowed

    Precautionary statement(s)
    Prevention

    P264 Wash ... thoroughly after handling.

    P270 Do not eat, drink or smoke when using this product.

    Response

    P301+P316 IF SWALLOWED: Get emergency medical help immediately.

    P321 Specific treatment (see ... on this label).

    P330 Rinse mouth.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    Cosmetic peptides,beauty raw materials,custom peptides,pharmaceutical intermediates

    Location:

    Unit 12, Building 10, No.77, Tianmu Road, Gaoxin West District, Yi County, Chengdu City, Sichuan Province

    Payment Terms:

    TT against copy of documents

    Average lead Time:

    7

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2015

    Certifications:

    ISO9001

    Chengdu YoungShe Chemical Co., Ltd is a new and dynamic high-tech enterprise that is constantly innovating and specializing in the development of beauty peptides. The company is headquartered in Chengdu Hi-tech Development Zone. Since its establishment in early 2015, the company has launched hundreds of beauty peptide products with different functions, which are widely sold at home and abroad.

    Chengdu Youngshe Chemical Co., Ltd.'s main cosmetic peptide products are dipeptide, tripeptide, tetrapeptide, pentapeptide, hexapeptide, and seven peptides ( heptapeptide, octapptide, nonapeptide, decapeptide, and oligopeptide.


  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Vietnam

    Calcitonin salmon supplier API Pharmaceutical Polypeptide Protected amino acids made in china

    100 G Jul 19, 2023
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.