 Home > Biochemical Engineering > Polypeptide > GALANIN, HUMAN for Sale > Galanin, human

Galanin, human

Name: Galanin, human
Brand: GT peptide
SKU: pr2104151526
Price: 1 USD
Availability: InStock

GMP ISO 1 Inquiries

Unit Price: Get Latest Price 

CAS No.:

119418-04-1

Grade:

Research and Industrial Grade

Content:

98%

Brand:

GT peptide

Packaging:

Plastic bottles

Sample Available:

Yes

Price valid (until):

2022-04-15

Contact Supplier

 Chat Now

Hangzhou Go Top Peptide Biotech Co.,Ltd.

Company Type:

Manufactory

Location:

China

Payment Terms:

TT against copy of documents

Average Lead Time:

7 days

Qualification:

Main Products:

Pharmaceutical Peptide,Cosmetic peptide,Custom peptides,API polypeptide,Amino acids and derivatives,Peptide - Teriparatide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Hangzhou Go Top Peptide Biotech is a technology-based and ISO9001-CERTIFIED peptide company and National High-tech Enterprise located in Hangzhou, China. Main service include Custom peptide synthesis, Peptide CRO/CDMO,Non-GMP and GMP peptide, Cosmetic peptide.

Pharmaceutical Peptide:

Semaglutide,Liraglutide,Dulaglutide,Thymalfasin,Eptifibatide,Leuprolide Acetate, Etelcalcetide,Teduglutide,Abaloparatide,Terlipressin,Aviptadil,Icatibant,Bremelanotide

Cosmetic Peptide:

Conotoxin / Conopeptide, Copper peptide / GHK-Cu,Acetyl hexapeptide-8/ Argireline, Nonapeptide-1, Glutathione,Palmitoyl Pentapeptide-4 and more.

Custom Peptide and CDMO

We provide Custom Peptide Synthesis with modifications from lab scale to pilot scale and Commercialization. Production capacity is from milligram to multi-kilograms.

The company web site: https://www.gtpeptide.com

ECHEMI Editorial Reference

Galanin (GAL) is a neuropeptide composed of 29 amino acids. It has wide range of expression in central and peripheral nervous system. It acts as a ligand for three G-protein coupled receptor (GPCR) subtypes called GalR1, GalR2 and GalR3.

Certificates

Basic Info

Product Name:

GALANIN, HUMAN

Other Name:

H-GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-VAL-GLY-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-ASN-GLY-LEU-THR-SER-OH;GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS;GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-VAL-GLY-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-ASN-GLY-LEU-THR-SER;GALANIN, HUMAN;GALANIN (1-30) (HUMAN);M.W. 3157.41 C139H210N42O43;GALANIN, HUMANGALANIN;Galanin, people

CAS No.:

119418-04-1

Molecular Formula:

C139H210N42O43

InChIKeys:

CBSXZYWGVAQSHI-RUKUCZSXSA-N

Molecular Weight:

3157.41

Color/Form:

White

Categories:

Polypeptide

Characteristics

Water Solubility:

Soluble to 0.50 mg/ml in water

Critical Temperature & Pressure:

−20°C

Hazard Identification

Classification of the substance or mixture

no data available

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)	no data available
Signal word	no data available
Hazard statement(s)	no data available
Prevention	no data available
Response	no data available
Storage	no data available
Disposal	no data available

Other hazards which do not result in classification

no data available

Handling and Storage

Precautions for safe handling

Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

Conditions for safe storage, including any incompatibilities

Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

See More GALANIN, HUMAN Safety Data Sheet 

Seller Information

Business Type:
Manufactory

Main Products:
Pharmaceutical Peptide,Cosmetic peptide,Custom peptides,API polypeptide,Amino acids and derivatives,Peptide - Teriparatide

Location:
5th Floor, Building 1, No. 600 Yinhai Street, Xiasha Street

Payment Terms:
TT against copy of documents

Average lead Time:
7 days

Total Annual Revenue:
$10 million-$25 million

Total Employees:
51-100

Year of Establishment:
2014

Hangzhou Go Top Peptide Biotech , established in 2014, is a technology-based peptide company and a National High-tech Enterprise located in Hangzhou of China. It is also the governing unit of Peptide Branch of China Biochemical Pharmaceutical Industry Association.
The company currently has a peptide research center in Hangzhou, covering an area of 2,000m2 . There are two cooperation plants for peptide commercialization located in Shangyu and Anji of Zhejiang province. The peptide center has equipped with several complete peptide productions lines, including several large-scale peptide synthesizers and advanced imported HPLC systems with different sizes. We also have GMP standard clean laboratories to meet client’s special needs. The company has passed ISO9001:2015 certification.
At present, the company has developed more than 40 mature pharmaceutical peptides, with the annual production capacity up to 100 kilograms. With a total of 20,000 custom peptides so far, we can provide the one-stop peptide services from research scale (mg) - pilot scale - commercial production(KGs).

English web site https://www.gtpeptide.com
Products and Services
1.Custom peptide synthesis, such as Research peptide, Neoantigen peptide, Clinical peptide.
2.Pharmaceutical peptide development and production.
3.Peptide CRO and CDMO.
4. Cosmetic peptide and formulation development.
5. Special protected amino acids and small molecules.
6. Commercialized peptide library.
7. Technical support of new drug development.

SHELLY HU Director of sales 13735575465 sales1@gotopbio.com
Cindy Mei The sales manager 13588827304 sales3@gotopbio.com

Inquiry History

1 Inquiries

Country	Product	Purchase Quantity	Date Posted
Canada	Galanin	5 G	Jan 26, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
GALANIN, HUMAN	/99		Shaanxi Cuikang Pharmaceutical Technolog	Inquiry
Galanin, human 99% white powder kanbei	Industrial Grade/99		Henan Lihao Chem Plant Limited	Inquiry

Galanin, human

Product Description

Seller Information