Gastric inhibitory polypeptide
100040-31-1
99%
Bottle,barrel,cargo,container,etc.
Yes
2026-11-18
Intermediates,Building blocks,API,Silicones,Peptides,Lab chemicals
-
Product Description
-
Seller Information
-
DescriptionKeywords
100040-31-1
Gastric inhibitory polypeptide
Quick DetailsProName:Gastric inhibitory polypeptide
CasNo:100040-31-1
Appearance:powder, or liquid
Application:Pharmaceuticals, intermediates, APIs, custom synthesis, chemicals
DeliveryTime:5-7 Days
PackAge:Bottle, barrel, cargo, container, etc.
Port:Shanghai
Purity:99
Storage:Stored in room temperature, ventilated place
Transportation:By air, ship, express, etc.
LimitNum:0
Grade:Industrial Grade
SuperiorityBest Seller, High Quality, Competitive Price, Fast Delivery, Quick Response
DetailsLEAPChem supplies high quality Pharmaceuticals, intermediates, APIs, custom synthesis, fine chemicals and other industrial chemicalsECHEMI Editorial ReferenceGIP was originally isolated as a gastric inhibitory polypeptide. After the discovery of its glucose-dependent insulinotropic activity, known as the incretin effect, GIP was renamed glucose-dependent insulinotropic peptide.Gastric inhibitory peptideAbbreviation: GIPAdditional names: gastric inhibitory polypeptide,gastrointestinal inhibitory peptide, glucose-dependent, insulinotropic peptide
Human GIP: Mr 4983.6, theoretical pI 6.92. GIP is soluble in water, but insoluble in ethanol. GIP is inactivated by DPP-4.
GIP was originally isolated from the porcine intestinal extract on the basis of its acid inhibitory activity in dogs (gastric inhibitory polypeptide) in the early 1970s, and subsequently renamed glucose-dependent insulinotropic peptide after the finding of its physiologically important role as a potentiator of glucose-stimulated insulin secretion.
GIP Human Recombinant produced in E. coli is a single polypeptide chain containing 155 amino acids (22-153) and having a molecular mass of 17.3kDa. GIP is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
EcoliResearch & Reference NoteGastric inhibitory polypeptide is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Authoritative sourcesDisclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals
Basic Info-
Product Name:
GIP (HUMAN)
Other Name:H-TYR-ALA-GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN-OH;GLUCOSE-DEPENDENT INSULINOTROPIC POLYPEPTIDE (HUMAN);GASTRIC INHIBITORY PEPTIDE HUMAN;GASTRIC INHIBITORY POLYPEPTIDE (HUMAN);GIP (HUMAN);GIP;YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ;TYR-ALA-GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN
CAS No.:100040-31-1
Molecular Formula:C226H338N60O66S
InChIKeys:MGXWVYUBJRZYPE-YUGYIWNOSA-N
Molecular Weight:4983.52932
Color/Form:White to off-white
Categories:
Characteristics-
Water Solubility:
Soluble to 1 mg/ml in water
Critical Temperature & Pressure:−20°C
-
-
Seller Information
-
Business Type:
Trader
-
Main Products:
Intermediates,Building blocks,API,Silicones,Peptides,Lab chemicals
-
Location:
Room A, 23rd Floor, No. 609 Yan'an Road, Gongshu District, Hangzhou, Zhejiang
-
Payment Terms:
TT against copy of documents,D/P,L/C
-
Average lead Time:
5 days
-
Total Annual Revenue:
Above $100 million
-
Year of Establishment:
2020
Company Certificates-
ISO
">Company ProfileLEAPChem is a specialized fine chemical supplier for research, development and production.
LEAPChem provides nearly 200,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner.
Our client list includes many major pharmaceutical and science companies, universities, research institutions and chemical catalogue companies.
Methodology: Sound & Stable; Active & Innovative.
Attitude: Conscientious; Ingenious.
Goals: Customer's Satisfaction
We regard client's success as our success.
At LEAPChem, we strive to be the preferred supplier for efficiency increasing and cost lowering in your Research & Production.
To achieve this strategic vision, we always push ourselves to exceed our customer's requirement. By focusing on the aim of 'Beyond Your Expectation', we continually expand our product lines, and enhance our systematic management and human resources.
Welcome to contact us and we look forward to becoming your reliable and preferred partner.
-
-
Country Product Purchase Quantity Date Posted Post an enquiry for this product
More from this Seller
-
-
-
(R)-(-)-2-Chloromandelic acid
/ 99.00%
-
-
-
![3,5-Dichlorosulfanilamide]( "3,5-Dichlorosulfanilamide")
-
3,5-Dichlorosulfanilamide
/ 99.00%
-
-
-
![Xylanase from Trichoderma viride]( "Xylanase from Trichoderma viride")
-
Xylanase from Trichoderma viride
/ 99.00%
-
-
-
![Cyclopropanecarbonitrile]( "Cyclopropanecarbonitrile")
-
Cyclopropanecarbonitrile
/ 99.00%
-
-
-
![5-Fluoro-2-pyrimidinecarbonitrile]( "5-Fluoro-2-pyrimidinecarbonitrile")
-
5-Fluoro-2-pyrimidinecarbonitrile
/ 99.00%
-
