Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > GIP (HUMAN) for Sale > GIP (HUMAN) 98% Powder 100040-31-1 Senwayer
GIP (HUMAN) 98% Powder 100040-31-1 Senwayer buy - large image1
GIP (HUMAN) 98% Powder 100040-31-1 Senwayer buy - image1
GIP (HUMAN) 98% Powder 100040-31-1 Senwayer buy - image2

GIP (HUMAN) 98% Powder 100040-31-1 Senwayer

GMP KOSHER

Unit Price: Get Latest Price
CAS No.:

100040-31-1

Grade:

Top Product

Content:

98%

Port:

Wuhan

Brand:

Senwayer

Packaging:

vials,foil bag,drums

Price valid (until):

2024-04-26

Company Type:
Trader
Location:
China
Qualification:
Main Products:

API,nutrition supplements,plant extract,peptide,HCG,6-Aminocaproic acid

  • Product Description

  • Seller Information

  • Description


      Product Detail  



    Product name

    GIP (HUMAN)

    Shelf Life2 Years
    COAAvailable
    OriginChina


    GIP, also known as gastric inhibitory polypeptide, or glucose-dependent insu linotropic polypeptide, is a 42-amino-acid peptide hormone synthesized in and secreted from K cells in the intestinal epithelium. There are two major GIP molecular forms in circulation, GIP (1-42) and GIP(3-42). Previous studies have demonstrated that GIP (3-42) is a degraded form of GIP (1-42) by the enzyme DPPIV. GIP secretion is primarily regulated by nutrients, especially fat. GIP exhibits potent incretin activity in rodent and human subjects. The primary action of GIP is the stimulation of glucose-dependent insu lin secretion. GIP may also play a role in adipocyte biology.


    Our Advantage

    1. Rich experience.
    Our company is a professional production leading factory in China in pharmaceutical area of many years, our products have exported to Germany, Spain, UK, USA, Australia, Middle East, and so on other country, and we have got very good feedback from our customers, we had Established long friendly relations of cooperation.


    2. Great quality, purity and favourable.
    Good quality is one of our secret success, welcome order the samples, MOQ just 5 grams.


    3. Safe and fast delivery.
    We have stock, so we can delivery quickly at the very day when receive the payment.


    We have special way could ship 0.01kg to 3.5kg products a time. We offer melting powder into liquid service. And ship the liquid in special bottles.


    4. Good after-sales service.

    Tell me the package update, and will try best solve when customer encountered various problems.


    FAQ

    Q1:Can i get free sample ?
    A: Yes, most product we can send you small free sample, you just need to pay the shipping cost .

    Q2:Which payment method you accept?
    A: We accept bank transfer,western union, money gram,bitcoin, USDT,Credit card etc. and more bigger order we accept L/C at sight

    Q3: Can i get tracking number after shipment ? and how long does the shipping take?
    A: After shipment we will offer you tracking and tell you the website to track the package, usually the shipping time is 3-7days,but for some customers have no ability to declare customs, we use special line route to ship the package, it will take 10-12days to arrive,make sure 100% delivery

    Q4: How can you guarantee the quality ?
    A: All products we can supply you test report &you can also send our product to the third party to do test, if it is fake,we will full refund you.





















    ECHEMI Editorial Reference
    GIP was originally isolated as a gastric inhibitory polypeptide. After the discovery of its glucose-dependent insulinotropic activity, known as the incretin effect, GIP was renamed glucose-dependent insulinotropic peptide.Gastric inhibitory peptideAbbreviation: GIPAdditional names: gastric inhibitory polypeptide,gastrointestinal inhibitory peptide, glucose-dependent, insulinotropic peptide
    Human GIP: Mr 4983.6, theoretical pI 6.92. GIP is soluble in water, but insoluble in ethanol. GIP is inactivated by DPP-4.
    GIP was originally isolated from the porcine intestinal extract on the basis of its acid inhibitory activity in dogs (gastric inhibitory polypeptide) in the early 1970s, and subsequently renamed glucose-dependent insulinotropic peptide after the finding of its physiologically important role as a potentiator of glucose-stimulated insulin secretion.
    GIP Human Recombinant produced in E. coli is a single polypeptide chain containing 155 amino acids (22-153) and having a molecular mass of 17.3kDa. GIP is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
    Ecoli
    Research & Reference Note

    GIP (HUMAN) 98% Powder 100040-31-1 Senwayer is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    GIP (HUMAN)

    Other Name:

    H-TYR-ALA-GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN-OH;GLUCOSE-DEPENDENT INSULINOTROPIC POLYPEPTIDE (HUMAN);GASTRIC INHIBITORY PEPTIDE HUMAN;GASTRIC INHIBITORY POLYPEPTIDE (HUMAN);GIP (HUMAN);GIP;YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ;TYR-ALA-GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN

    CAS No.:

    100040-31-1

    Molecular Formula:

    C226H338N60O66S

    InChIKeys:

    MGXWVYUBJRZYPE-YUGYIWNOSA-N

    Molecular Weight:

    4983.52932

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

  • Seller Information
    Business Type:

    Trader

    Main Products:

    API,nutrition supplements,plant extract,peptide,HCG,6-Aminocaproic acid

    Location:

    Room 707, Block A, Zhongxing Times Digital Trade Port, No. 79 Xudong Street, Hongshan District, Wuhan City

    Payment Terms:

    TT against copy of documents,L/C

    Average lead Time:

    10

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    51-100

    Year of Establishment:

    2020

    Certifications:

    Verified supplier certificate,SGS

      Dingwang Technology (Wuhan) Co., Ltd located in the predominant WuHan City where is a traffic hinge of China,specilize in producing and developing pharmaceutical & its intermediates, Peptide, Nutritional supplements,food additive, Plant extracts,and in distributing the products of our own company and affiliated enterprises.
          We have set up R&D center, quality inspection center and manufacturing site in Wuhan, Jiangsu and others places.

    Our company has professional staff who deal with chemical R&D and scientific management, and holds several sets of analyzing instruments with high efficiency and high sensitivity, such as HPLC, GC and Spectrophotometer. Meanwhile, we possess of complete Q.A. and Q.C. system, supply chemical products with good quality and custom-tailored products according to our clients' requirement.
           We have professional sales team, focus on quality and service, and we have achieved excellent performance over the years. Our company is committed to the development of international market , our products are mainly exported to many countries and regions, such as Europe, America, South-east Asia, the Middle East and Africa etc.
         With our constant efforts and good service, We sincerely hope to establish long-term cooperation and common development with our customers.
  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.