Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > Antibacterial Protein LL-37,ll-37,Ll 37 98% Peptide Powder 154947-66-7 Senwayer
Antibacterial Protein LL-37,ll-37,Ll 37 98% Peptide Powder 154947-66-7 Senwayer buy - large image1
Antibacterial Protein LL-37,ll-37,Ll 37 98% Peptide Powder 154947-66-7 Senwayer buy - image1
Antibacterial Protein LL-37,ll-37,Ll 37 98% Peptide Powder 154947-66-7 Senwayer buy - image2
Antibacterial Protein LL-37,ll-37,Ll 37 98% Peptide Powder 154947-66-7 Senwayer buy - image3

Antibacterial Protein LL-37,ll-37,Ll 37 98% Peptide Powder 154947-66-7 Senwayer

GMP KOSHER 3 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Top Product

Content:

98%

Port:

Wuhan

Brand:

Senwayer

Packaging:

vials,foil bag,drums

Price valid (until):

2024-04-26

Company Type:
Trader
Location:
China
Qualification:
Main Products:

API,nutrition supplements,plant extract,peptide,HCG,6-Aminocaproic acid

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    • 1. Product Basic Information

      NameLL-37
      Molecular formulaC205H341N61O52
      Molecular weight4492.27854
      Storage condition-20°C

    LL-37 is an anti-microbial peptide. It has been shown to have antimicrobial activity against multiple Gram-positive and Gram-negative human pathogens. Antimicrobial peptides (AMPs) have the potential to serve as an alternative to antibiotics. It's simple, AMPs kill the microbial pathogens (the bugs). AMPs can possibly regulate bacteriirus invasion and may control infection. It has been reported that AMPs could be used to activate response the innate mucosal immune response in order to get rid of the infections. (Mucosal referers to the immune response at mucosal membranes of the intestines, the urogenital tract and the respiratory system, i.e., surfaces that are in contact with the external environment). LL37 belongs to the cathelicidin family of AMPs. It is released as a mature peptide when neutrophils (type of white blood cells) are stimulated. LL37 is expressed in various cells and tissues such as circulating neutrophils, bone marrow cells, epithelial cells of the skin, cells in the gastrointes tinal tract, as well as in the epididymis and lungs.Production of LL37 in macrophages is stimulated by vitamin D released by sunlight through the skin. LL37 plays an important role in the first line of defense against infection and systemic invasion of pathogens at site inflammation and wounds. It is toxic to both bacterial and normal cells and is very resistant to proteolytic degradation. Staphylococcus aureus, (staph for short), is one of the largest problems facing modern medicine, particularly since it has become resistant to a number of antibiotics. Research with LL37 shows that it is effective again against staph at nanomolar concentrations. It kills the bacteria both when it invades cells and when it is free, and is more effective than conventional antibiotics. These features make LL37 of particularmedical interest to the al field and it is hoped that the peptide will be useful in treating chronic infections, such as those who have diabetes or immune system dysfunction. It has also b een effective in treating Candida albicans and E. coli.Several studies show that LL37 is effective in treating certain cancer cell types. LL37 inhibits gastric cancer cell proliferation by the activation of bone morphogenetic protein (BMP) signaling.However, overexpression of LL-37 was found to promote development and progression of ovarian, lung and breast cancers.


    FAQ

    Q1:Can i get free sample ?
    A: Yes, most product we can send you small free sample, you just need to pay the shipping cost .

    Q2:Which payment method you accept?
    A: We accept bank transfer,western union, money gram,bitcoin, USDT,Credit card etc. and more bigger order we accept L/C at sight

    Q3: Can i get tracking number after shipment ? and how long does the shipping take?
    A: After shipment we will offer you tracking and tell you the website to track the package, usually the shipping time is 3-7days,but for some customers have no ability to declare customs, we use special line route to ship the package, it will take 10-12days to arrive,make sure 100% delivery

    Q4: How can you guarantee the quality ?
    A: All products we can supply you test report &you can also send our product to the third party to do test, if it is fake,we will full refund you.


    Our Advantage

    1. Rich experience.
    Our company is a professional production leading factory in China in pharmaceutical area of many years, our products have exported to Germany, Spain, UK, USA, Australia, Middle East, and so on other country, and we have got very good feedback from our customers, we had Established long friendly relations of cooperation.


    2. Great quality, purity and favourable.
    Good quality is one of our secret success, welcome order the samples, MOQ just 1 grams.


    3. Safe and fast delivery.
    We have stock, so we can delivery quickly at the very day when receive the payment.

    We have special way could ship 0.01kg to 3.5kg products a time. We offer melting powder into liquid service. And ship the liquid in special bottles.


    4. Good after-sales service.

    Tell me the package update, and will try best solve when customer encountered various problems.





















    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    Antibacterial Protein LL-37,ll-37,Ll 37 98% Peptide Powder 154947-66-7 Senwayer is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    API,nutrition supplements,plant extract,peptide,HCG,6-Aminocaproic acid

    Location:

    Room 707, Block A, Zhongxing Times Digital Trade Port, No. 79 Xudong Street, Hongshan District, Wuhan City

    Payment Terms:

    TT against copy of documents,L/C

    Average lead Time:

    10

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    51-100

    Year of Establishment:

    2020

    Certifications:

    Verified supplier certificate,SGS

      Dingwang Technology (Wuhan) Co., Ltd located in the predominant WuHan City where is a traffic hinge of China,specilize in producing and developing pharmaceutical & its intermediates, Peptide, Nutritional supplements,food additive, Plant extracts,and in distributing the products of our own company and affiliated enterprises.
          We have set up R&D center, quality inspection center and manufacturing site in Wuhan, Jiangsu and others places.

    Our company has professional staff who deal with chemical R&D and scientific management, and holds several sets of analyzing instruments with high efficiency and high sensitivity, such as HPLC, GC and Spectrophotometer. Meanwhile, we possess of complete Q.A. and Q.C. system, supply chemical products with good quality and custom-tailored products according to our clients' requirement.
           We have professional sales team, focus on quality and service, and we have achieved excellent performance over the years. Our company is committed to the development of international market , our products are mainly exported to many countries and regions, such as Europe, America, South-east Asia, the Middle East and Africa etc.
         With our constant efforts and good service, We sincerely hope to establish long-term cooperation and common development with our customers.
  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.