Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 | Factory sales 375| Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder
LL37 | Factory sales 375| Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - large image1
LL37 | Factory sales 375| Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image1
LL37 | Factory sales 375| Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image2
LL37 | Factory sales 375| Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image3
LL37 | Factory sales 375| Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image4
LL37 | Factory sales 375| Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image5
LL37 | Factory sales 375| Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image6

LL37 | Factory sales 375| Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder

TDS 3 Inquiries

Unit Price:

$65/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.99%

Port:

Guangzhou

Brand:

Yiwu Weide

Packaging:

5mg/vial 10vials/unit

Price valid (until):

2027-08-08

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide raw,Tirzepatide raw,TB500 raw

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Contact me via WhatsApp:

    +85266411984

    https://wa.me/message/DBPBVD6G2TARE1

    duanuan@gmail.com


    Shop MT-2 Factory price Top quality 121062-08-6  Melanotan 2 Acetate Cheapest prcie-Detailed Image 1

    Our company has been engaged in biochemical raw materials for many years. We focus on high-quality research raw materials to serve global researchers and laboratories.


    We own stable supply channels and strict quality inspection standards. Every batch of products is well packed to guarantee intact delivery to customers.


    We support flexible order quantities and offer professional technical support. Our team provides 24-hour online service to solve your inquiries about products, samples, logistics and orders.


    We adhere to integrity-oriented cooperation. We look forward to establishing long-term, stable partnerships with clients all over the world.


    We believe that High Purity Lyophilized Peptide offers an unbeatable combination of quality, performance, and value.

    Thank you for considering High Purity Lyophilized Peptide. We look forward to the opportunity to work with you and help you achieve success.

    Shop Retatrtide raw material 10mg 20mg 30mg 40mg 50mg 60mg per bottles-Detailed Image 1

    Products Description

    Factory supply high purity lyophilized peptide powder, widely used for cosmetic production, lab scientific research and health care supplement, customizable specification & OEM service supported.

    Shop Retatrtide raw material 10mg 20mg 30mg 40mg 50mg 60mg per bottles-Detailed Image 2 Shop Retatrtide raw material 10mg 20mg 30mg 40mg 50mg 60mg per bottles-Detailed Image 3

    Features:

    [≥99% high purity, tested by HPLC with available COA certificate]

    [Good water soluble, white freeze-dried powder form]

    [Multiple specifications:5mg/10mg/15mg/25mg per sterile vial]]

    [Support OEM & ODM customized packaging and label service]

    [Strictly sealed packing, long shelf life up to 24 months]

    Shop Retatrtide raw material 10mg 20mg 30mg 40mg 50mg 60mg per bottles-Detailed Image 4 Shop Retatrtide raw material 10mg 20mg 30mg 40mg 50mg 60mg per bottles-Detailed Image 5

    Benefits:

    [Stable high purity raw material reduces your finished product reject rate]

    [Small MOQ 1 box helps new buyers cut trial procurement cost

    [Custom split-pack saves your later repack labor cost]

    [Factory direct price removes intermediate markup to improve your profit margin]

    Shop Retatrtide raw material 10mg 20mg 30mg 40mg 50mg 60mg per bottles-Detailed Image 6 Shop Retatrtide raw material 10mg 20mg 30mg 40mg 50mg 60mg per bottles-Detailed Image 7

    Shipping

    1. Shipping Scope

    We provide worldwide shipping services to most regions. Buyers need to confirm whether related products can be imported legally in their local country before ordering.

    Shop MT-2 Factory price Top quality 121062-08-6  Melanotan 2 Acetate Cheapest prcie-Detailed Image 9

    2. Shipping Time

     After payment confirmed and goods dispatched:

    Normal transit time: 7–18 working days, affected by local customs clearance, weather and logistics conditions.


    3. Shipping Tracking

     Once the parcel is sent out, we will provide you with the tracking number. You can track delivery status online.

    Shop KPV10mg peptide Lysine-Proline-Valine Pure KPV 5mg High Purity-Detailed Image 10 Shop KPV10mg peptide Lysine-Proline-Valine Pure KPV 5mg High Purity-Detailed Image 11

    4. Delivery Exception

     If the package is detained, lost or returned during transportation, please contact us immediately with tracking information for further handling.


    Items Specifications
    Product Certification COA
    Purity 99.9%
    Material
    Lyophilized peptide
    Solubility Water Soluble
    Package Sterile 5mg/10mg Glass Via
    MOQ 1 Box Available

    Shelf Life

    2 Years

    Shop MT-2 Factory price Top quality 121062-08-6  Melanotan 2 Acetate Cheapest prcie-Detailed Image 10
    Disclaimer

    1. Product Purpose Statement

     All products displayed on this website are for laboratory scientific research use ONLY.

    Products are strictly NOT for human consumption,clinical treatment or food additive use.

    2. Buyer Responsibilities

     Each buyer must confirm and abide by local laws, customs regulations on importing research peptides before purchase.

    3. No Medical Advice

     All content on the website cannot be regarded as medical suggestions. We do not provide any diagnosis, treatment or medical guidance service.

    4. Information Accuracy

     We strive to ensure product data descriptions are accurate, but we do not guarantee there is zero error on website information. Specifications are subject to the latest official test report.

    5. Policy Revision

     We reserve the right to revise this disclaimer at any time, and the updated version shall take effect once published online.

    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL37 | Factory sales 375| Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • LL37 | Factory sales 375| Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide raw,Tirzepatide raw,TB500 raw

    Location:

    Room 402, Unit 2, Building 23, Dalutou Village, Jiangdong Sub-district, Yiwu City, Jinhua City, Zhejiang Province (Self-declared)

    Year of Establishment:

    2025

    Established in 2025, Yiwu Weide Trading Company specializes in the research, development, production, and sales of peptide products, synthetic peptide amino acids, beauty and weight-loss products, and raw materials for cosmetics designed to reduce dark spots. The company possesses strong R&D capabilities, sophisticated synthesis technologies, and advanced quality control methods. It actively collaborates with major enterprises and manufacturers, adhering to the philosophy of industrial development to serve society and its customers. The company consistently prioritizes market demand, continuously developing high-tech beauty peptides for spot removal and wrinkle reduction. Its products are primarily exported to the United States, Europe, South Africa, Nigeria, and other countries and regions. With extensive export experience, the company ensures the safe delivery of its shipments.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.