 Home > Biochemical Engineering > Polypeptide > GLUCAGON (1-37) (PORCINE) for Sale > High Quality Oxyntomodulin Peptide Powder CAS 62340-29-8 Glucagon (1-37) Senwayer

High Quality Oxyntomodulin Peptide Powder CAS 62340-29-8 Glucagon (1-37) Senwayer buy - large image1

High Quality Oxyntomodulin Peptide Powder CAS 62340-29-8 Glucagon (1-37) Senwayer

Name: High Quality Oxyntomodulin Peptide Powder CAS 62340-29-8 Glucagon (1-37) Senwayer
Brand: Senwayer
SKU: pr2307281705
Price: 100 USD
Availability: InStock

GMP KOSHER

Unit Price: Get Latest Price 

CAS No.:

62340-29-8

Grade:

Top Product

Content:

95%

Port:

Wuhan

Brand:

Senwayer

Packaging:

vials,foil bag,drums

Price valid (until):

2024-04-26

Contact Supplier

 Chat Now

Dingwang Technology (Wuhan) Co., Ltd.

Company Type:

Trader

Location:

China

Payment Terms:

TT against copy of documents,L/C

Average Lead Time:

10 days

Qualification:

Main Products:

API,nutrition supplements,plant extract,peptide,HCG,6-Aminocaproic acid

 Visit Store

Product Description
Seller Information

Description
Product Detail

Product name
Oxyntomodulin
Shelf Life 2 Years
COA Available
Origin China

Oxyntomodulin (OXM) is a peptide secreted from the L cells of the gut following nutrient ingestion. OXM is a dual agonist of the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR) combining the effects of GLP1 and glucagon to act as a potentially more effective treatment for obesity than GLP1R agonists. Injections of OXM in humans cause a significant reduction in weight and appetite, as well as an increase in energy expenditure. Activation of GCGR is classically associated with an elevation in glucose levels, which would be deleterious in patients with T2DM, but the antidiabetic properties of GLP1R agonism would be expected to counteract this effect. Indeed, OXM administration improved glucose tolerance in diet-induced obese mice. Thus, dual agonists of the GCGR and GLP1R represent a new therapeutic approach for diabetes and obesity with the potential for enhanced weight loss and improvement in glycemic control beyond those of GLP1R agonists.

Our Advantage
1. Rich experience.
Our company is a professional production leading factory in China in pharmaceutical area of many years, our products have exported to Germany, Spain, UK, USA, Australia, Middle East, and so on other country, and we have got very good feedback from our customers, we had Established long friendly relations of cooperation.

2. Great quality, purity and favourable.
Good quality is one of our secret success, welcome order the samples, MOQ just 5 grams.

3. Safe and fast delivery.
We have stock, so we can delivery quickly at the very day when receive the payment.

We have special way could ship 0.01kg to 3.5kg products a time. We offer melting powder into liquid service. And ship the liquid in special bottles.

4. Good after-sales service.
Tell me the package update, and will try best solve when customer encountered various problems.

FAQ
Q1:Can i get free sample ?
A: Yes, most product we can send you small free sample, you just need to pay the shipping cost .
Q2:Which payment method you accept?
A: We accept bank transfer,western union, money gram,bitcoin, USDT,Credit card etc. and more bigger order we accept L/C at sight
Q3: Can i get tracking number after shipment ? and how long does the shipping take?
A: After shipment we will offer you tracking and tell you the website to track the package, usually the shipping time is 3-7days,but for some customers have no ability to declare customs, we use special line route to ship the package, it will take 10-12days to arrive,make sure 100% delivery
Q4: How can you guarantee the quality ?
A: All products we can supply you test report &you can also send our product to the third party to do test, if it is fake,we will full refund you.
Research & Reference Note

High Quality Oxyntomodulin Peptide Powder CAS 62340-29-8 Glucagon (1-37) Senwayer is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Authoritative sources

PubChem

ClinicalTrials.gov

FDA Drugs@FDA

NIH
Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals
Certificates
Basic Info

Product Name:
GLUCAGON (1-37) (PORCINE)

Other Name:
OXYNTOMODULIN;Oxyntomodulin (porcine, bovine);OXYNTOMODULIN (PORCINE);ENTEROGLUCAGON;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;GLUCAGON 37;GLUCAGON 1-37

CAS No.:
62340-29-8

Molecular Formula:
C192H295N59O60S

Molecular Weight:
0

Color/Form:
White to off-white

Categories:
Polypeptide

Characteristics

Water Solubility:
Soluble to 1 mg/ml in water

Critical Temperature & Pressure:
Desiccate at -20°C
Seller Information

Business Type:
Trader

Main Products:
API,nutrition supplements,plant extract,peptide,HCG,6-Aminocaproic acid

Location:
Room 707, Block A, Zhongxing Times Digital Trade Port, No. 79 Xudong Street, Hongshan District, Wuhan City

Payment Terms:
TT against copy of documents,L/C

Average lead Time:
10 days

Total Annual Revenue:
$2.5 million-$5 million

Total Employees:
51-100

Year of Establishment:
2020

Company Certificates
- Verified supplier certificate
- SGS
Dingwang Technology (Wuhan) Co., Ltd located in the predominant WuHan City where is a traffic hinge of China,specilize in producing and developing pharmaceutical & its intermediates, Peptide, Nutritional supplements,food additive, Plant extracts,and in distributing the products of our own company and affiliated enterprises.
We have set up R&D center, quality inspection center and manufacturing site in Wuhan, Jiangsu and others places.
Our company has professional staff who deal with chemical R&D and scientific management, and holds several sets of analyzing instruments with high efficiency and high sensitivity, such as HPLC, GC and Spectrophotometer. Meanwhile, we possess of complete Q.A. and Q.C. system, supply chemical products with good quality and custom-tailored products according to our clients' requirement.
We have professional sales team, focus on quality and service, and we have achieved excellent performance over the years. Our company is committed to the development of international market , our products are mainly exported to many countries and regions, such as Europe, America, South-east Asia, the Middle East and Africa etc.
With our constant efforts and good service, We sincerely hope to establish long-term cooperation and common development with our customers.
Country Product Purchase Quantity Date Posted

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Glucagon (1 - 37), porcine; Oxyntomodulin, porcine	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry

High Quality Oxyntomodulin Peptide Powder CAS 62340-29-8 Glucagon (1-37) Senwayer

Product Description

Seller Information

Oxyntomodulin

More Choices Find All Products for Sale 

Related Searches

More from this Seller

Product name	Oxyntomodulin
Shelf Life	2 Years
COA	Available
Origin	China