Product
Supplier
Encyclopedia
Inquiry
Home > Food Additives > Nutrition Supplements > Glucagon for Sale > Manufacturer Supplying High Quality API powder Glucagon HCL with 16941-32-5
Manufacturer  Supplying High Quality API powder Glucagon HCL with  16941-32-5 buy - large image1
Manufacturer  Supplying High Quality API powder Glucagon HCL with  16941-32-5 buy - image1
Manufacturer  Supplying High Quality API powder Glucagon HCL with  16941-32-5 buy - image2
Manufacturer  Supplying High Quality API powder Glucagon HCL with  16941-32-5 buy - image3
Manufacturer  Supplying High Quality API powder Glucagon HCL with  16941-32-5 buy - image4
Manufacturer  Supplying High Quality API powder Glucagon HCL with  16941-32-5 buy - image5
Manufacturer  Supplying High Quality API powder Glucagon HCL with  16941-32-5 buy - image6

Manufacturer Supplying High Quality API powder Glucagon HCL with 16941-32-5

KOSHER ISO FDA 4 Inquiries

Unit Price: Get Latest Price
CAS No.:

16941-32-5

Grade:

Food grade

Content:

99%

Port:

shen zhen

Brand:

Flying

Packaging:

10g/1kg/ 10kg/ 25kg

Price valid (until):

2023-11-15

Company Type:
Trader
Location:
China
Qualification:
Main Products:

vitamin

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Superiority

    1.High quality and competitive price.
    2.Free sample for your evaluation.
    3.Promptly delivery by well-reputed shipping lines.
    4.Trial order is available for testing after samples.
    5.We will inform you all the information at every stage in advance.
    6.Packaging can gear to buyers’ special request. 

    Our service

    1. Reply your inquiry in 24 working hours.
    2. Customized design is available. OEM are welcomed.
    3. Exclusive and unique solution can be provided to our customer by our well-trained and professional engineers and
    staff.
    4. Professional factory: We are manufacturer, specializing in producing all kinds of herb extract for more than 10 years, competitive with good quantity.
    5. As an honest seller, we always use superior raw material, advanced machines, skilled technicians to ensure our products to be finished in high quality and stable feature.


    Hainan Flying International Trade Co., Ltd., was established in 2020, It is a professional supplier of Human APIs, Veterinary, Food Additives, Vitamins, Chemicals, Plant Extract and natural active ingredients. It has absolute advantage because of strong research strength, modern management system and high-quality marketing team.

    For customer’s needs, OEM service is also acceptable. If you have a good idea in new product production but lack of laboratory device and human resource, we are glad to solve this problem for you. Sincerely hope to strengthen exchanges and cooperation with friends from both home and abroad.

    .






    Shop Manufacturer  Supplying High Quality API powder Glucagon HCL with  16941-32-5-Detailed Image 1

    Shop Manufacturer  Supplying High Quality API powder Glucagon HCL with  16941-32-5-Detailed Image 2

    Shop Manufacturer  Supplying High Quality API powder Glucagon HCL with  16941-32-5-Detailed Image 3



    Shop Manufacturer  Supplying High Quality API powder Glucagon HCL with  16941-32-5-Detailed Image 4

    Shop Manufacturer  Supplying High Quality API powder Glucagon HCL with  16941-32-5-Detailed Image 5

    Shop Manufacturer  Supplying High Quality API powder Glucagon HCL with  16941-32-5-Detailed Image 6


    RAQ





    Q1: How to confirm the Product Quality before placing orders?
    A: By sending you available samples. Or if you have special requirements for the goods, we can prepare samples according to your requirement for confirmation.

    Q2: Can you supply free samples?
    A: Yes, we can provide a free sample, but the shipping cost will be paid by the customers. You can either pay the shipping cost or arrange a courier to collect the samples.

    Q3: How do you treat quality complaints?
    A: All our products are strictly tested by our QC and confirmed by QA; unqualified material will not be released to customers. In case any quality problem is confirmed to be caused by us, we will replace the goods or refund your payment immediately.

    Q4: What's your MOQ ?
    A: For the high value product, our MOQ starts from 1g and generally starts from 10gs. For other low, price product, our MOQ starts from 100g and 1kg.
    Q: Is there a discount ?
    A: Yes, for larger quantity, we always support with better price.

    Q5: How to start orders or make payments ?
    A: You can send our your Purchase order ( if your company has ), or just send a simple confirmation by email or by Trade Manager, and we will send you Proforma Invoice with our bank details for your confirmation, then you can make payment accordingly.


    ECHEMI Editorial Reference
    White or almost white powderProduced by the α cells of the islands of Langerhans and also by the gastric mucosa. It is opposite in effect to insulin. It appears to be a straight-chain polypeptide with a molecular weight of approximately 3500. Small amounts have been detected in commproduced by recombinant DNA technology ismarketed by Novo Nordisk (glucagon [recombinant] hydrochloride,GlucaGen HypoKit, GlucaGen Diagnostic Kit)and by Eli Lilly (glucagon [recombinant] Emergency Kit). The hypergly

    Certificates

    Basic Info
    Product Name:

    Glucagon

    Other Name:

    GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN

    CAS No.:

    16941-32-5

    Molecular Formula:

    C153H225N43O49S

    InChIKeys:

    MASNOZXLGMXCHN-ZLPAWPGGSA-N

    Molecular Weight:

    3482.75

    Exact Mass:

    3480.615723

    EC Number:

    232-708-2

    HScode:

    2937190000

    Categories:

    Nutrition Supplements

    Characteristics
    PSA:

    1564.04000

    XLogP3:

    -6.01

    Appearance:

    powder

    Density:

    1.53±0.1 g/cm3(Predicted)

    Refractive Index:

    1.682

    Water Solubility:

    Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.

    Storage Conditions:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Skin sensitization, Category 1

    Acute toxicity - Category 4, Inhalation

    Respiratory sensitization, Category 1

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Danger

    Hazard statement(s)

    H317 May cause an allergic skin reaction

    H332 Harmful if inhaled

    H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled

    Precautionary statement(s)
    Prevention

    P261 Avoid breathing dust/fume/gas/mist/vapours/spray.

    P272 Contaminated work clothing should not be allowed out of the workplace.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    P271 Use only outdoors or in a well-ventilated area.

    P284 [In case of inadequate ventilation] wear respiratory protection.

    Response

    P302+P352 IF ON SKIN: Wash with plenty of water/...

    P333+P317 If skin irritation or rash occurs: Get medical help.

    P321 Specific treatment (see ... on this label).

    P362+P364 Take off contaminated clothing and wash it before reuse.

    P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing.

    P317 Get medical help.

    P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.

    Storage

    none

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    vitamin

    Location:

    Room 2-502, Building 6, Luneng Tehran Garden Building, No.8 Changbin Road, Xiuying district, Haikou City, Hainan Province

    Payment Terms:

    TT against copy of documents,TT against B/L draft before shipment

    Average lead Time:

    25

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    Less than 5

    Year of Establishment:

    2023

  • Inquiry History
    4 Inquiries
    Country Product Purchase Quantity Date Posted
    Belgium

    Glucagon 16941-32-5 Pharmaceutical grade

    10 PCS Jan 8, 2026
    Belgium

    Glucagon (1-29)

    5 MG Jan 9, 2026
    Netherlands

    glucagon

    1000 KG Feb 15, 2024
    Bulgaria

    Glucagon, not retatrutide, just glucagon

    1 G May 10, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.