Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Factory Supply LL-37 99% White Powder Raw peptide powder 1g 10g 1kg
Factory Supply LL-37 99% White Powder Raw peptide powder 1g 10g 1kg buy - large image1
Factory Supply LL-37 99% White Powder Raw peptide powder 1g 10g 1kg buy - image1
Factory Supply LL-37 99% White Powder Raw peptide powder 1g 10g 1kg buy - image2
Factory Supply LL-37 99% White Powder Raw peptide powder 1g 10g 1kg buy - image3
Factory Supply LL-37 99% White Powder Raw peptide powder 1g 10g 1kg buy - image4
Factory Supply LL-37 99% White Powder Raw peptide powder 1g 10g 1kg buy - image5
Factory Supply LL-37 99% White Powder Raw peptide powder 1g 10g 1kg buy - image6

Factory Supply LL-37 99% White Powder Raw peptide powder 1g 10g 1kg

TDS

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

tianjin

Brand:

Yueqi

Packaging:

10mg/vial

Price valid (until):

2024-04-26

Company Type:
Trader
Location:
China
Qualification:
Main Products:

retatrutide,Semaglutide,tirzepatide,BPC-157,NAD,glutathione

  • Product Description

  • Seller Information

  • Description

    Factory Supply LL-37 99% White Powder Raw peptide powder 1g 10g 1kg


      Product Detail  


    Function and Usage of Liraglutide 204656-20-2

    1、 Type 2 diabetes
    Liraglutide improves control of blood glucose.It reduces meal-related hyperglycemia

    (for 24 hours after administration) by increasing insulin secretion (only) when required by increasing

    glucose levels, delaying gastric emptying, and suppressing prandial glucagon secretion.
    In common to various degrees with other GLP-1 receptor agonists, liraglutide has advantages over

    more traditional therapies for type 2 diabetes:

    ·  Liraglutide acts in a glucose-dependent manner, meaning it will stimulate insulin secretion only

    when blood glucose levels are higher than normal, preventing "overshoot". Consequently, it shows

    negligible risk of hypoglycemia.

    ·  Liraglutide has the potential for inhibiting apoptosis and stimulating regeneration of beta cells

    (seen in animal studies).

    ·  Liraglutide decreases appetite and inhibits body weight gain, as shown in a head-to-head study

    versus glimepiride.

    ·  Liraglutide lowers blood triglyceride levels.


    2、Obesity
    Liraglutide has been approved as an injectable adjunct to a reduced-calorie diet and increased

    physical activity for chronic weight management in adult patients. The specified criteria are an

    initial body mass index (BMI) of 30 kg/m2 or greater (obese), or 27 kg/m2 or greater

    (overweight), in the presence of at least one weight-related comorbid condition

    (e.g.hypertension, type 2 diabetes mellitus, or dyslipidemia). In late 2014, data were reported from

    the SCALE™ Obesity and Prediabetes trial, which is a randomised, double-blind, placebo-controlled,

    multinational trial in non-diabetic people with obesity and non-diabetic people who are overweight

    with comorbidities. In this phase 3a trial, there were 3,731 participants randomised to treatment

    with liraglutide 3 mg or placebo, both in combination with diet and exercise. Those who completed

    the 56-week trial achieved an average weight loss of 9.2%, to be compared with a 3.5% reduction in

    the placebo group.

    Items Specifications
    Name   Liraglutide 204756-20-2
    Purity 99%
    Grade Pharmaceutical grade

    Shop Weight Loss GLP-1 Injection Peptide 99% Purity Tirzepatide 10mg per vial-Detailed Image 1Shop Weight Loss GLP-1 Injection Peptide 99% Purity Tirzepatide 10mg per vial-Detailed Image 2Shop Weight Loss GLP-1 Injection Peptide 99% Purity Tirzepatide 10mg per vial-Detailed Image 3Shop Weight Loss GLP-1 Injection Peptide 99% Purity Tirzepatide 10mg per vial-Detailed Image 4Shop Weight Loss GLP-1 Injection Peptide 99% Purity Tirzepatide 10mg per vial-Detailed Image 5

    Shop Weight Loss GLP-1 Injection Peptide 99% Purity Tirzepatide 10mg per vial-Detailed Image 6Shop Weight Loss GLP-1 Injection Peptide 99% Purity Tirzepatide 10mg per vial-Detailed Image 7

    How is Retatrutide different from Semaglutide and Trizepatide ?

    Mechanism:

    1. Semaglutide work as (GLP-1) hormone agonist.

    2. Tirezepatide work as (GLP-1 & GIP ) hormone agonist.

    3. Retatrutide work as (GLP-1 & GIP & Glucagon) hormones agonist.


    Weight loss in trials:

    1. Semaglutide led to a 6-12% reduction in body weight in 28 weeks

    2. Tirezepatide led to a 15-20% reduction in body weight in 72 weeks

    3. Retatrutide led to a 25% reduction in body weight in 48 weeks

    Why choose us?

    1. Higher quality products (>=99% purity) for most of peptides and raws. Quality Guaranteed: Many HPLC test reports are available (Janoshik).

    2. Domestic warehouses and fast delivery.

    3. Ship worldwide with safe and secure lines: 100% delivery guaranteed. No worry about Customs issues.

    4. Special Service: Drop-shipping if need.

    5. Cheapest prices in the market, unbeatable!

    6. Many payment options: Paypal, bank transfer, alipay, wechat, bitcoin, USDT. 

    put...

    Shop 99% Purity Weight Loss Liraglutide 204756-20-2 best price-Detailed Image 8
    Shop 99% Purity Weight Loss Liraglutide 204756-20-2 best price-Detailed Image 9

    Certificates
    • Factory Supply LL-37 99% White Powder Raw peptide powder 1g 10g 1kg Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    retatrutide,Semaglutide,tirzepatide,BPC-157,NAD,glutathione

    Location:

    Erqi District, Zhengzhou City

    Payment Terms:

    TT against copy of documents,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    3

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2023

    Supplying 99%+ high quality chemical products

    More than 1,000 quality products|10 production lines|Provide OEM services

    Founded in 2015
    Founded in 2015, Zhengzhou Yueqi New Materials Co., Ltd is located in Zhengzhou, Henan Province. As one of the most dynamic factories and foreign trade companies in the Chinese market, we have a registered capital of RMB 3 million. 

    Our Benefits from Our Advantages
    We can provide fast delivery. The average lead time during the peak season is within 15 workdays, and in the off season is one month. We have successfully shipped many chemical raw materials to many countries around the world. Good feedbacks and repeat orders support the development of our company. 

    Independent Production Lines
    We have 10 production lines for pharmaceutical intermediates, organic solvents and other raw materials. In addition, we have an API production workshop with independent research and development production lines, as well as an API research and development test center. We can provide OEM services and accept small orders.

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.